missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Protéines recombinantes
  4. 30182769

Invitrogen™ Human FSD1 (aa 252-341) Control Fragment Recombinant Protein

Code produit. 30182769
Click to view available options
Quantité:
100 μl
Conditionnement:
100µL
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Code produit. 30182769

Marque: Invitrogen™ RP98974

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60255 (PA5-60255. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FSD1 encodes a centrosome associated protein that is characterized by an N-terminal coiled-coil region downstream of B-box (BBC) domain, a central fibronectin type III domain, and a C-terminal repeats in splA and RyR (SPRY) domain. The encoded protein associates with a subset of microtubules and may be involved in the stability and organization of microtubules during cytokinesis.
TRUSTED_SUSTAINABILITY

Spécification

Numéro d’adhésion Q9BTV5
Concentration ≥5.0 mg/mL
À utiliser avec (application) Blocking Assay, Control
Formule 1 M urea, PBS with no preservative; pH 7.4
Identification génétique (Entrez) 79187
Nom Human FSD1 (aa 252-341) Control Fragment
Quantité 100 μl
État réglementaire RUO
Alias de gène fibronectin type 3 and SPRY (spla, ryanodine) domain containing (with coiled-coil motif) 1; fibronectin type 3 and SPRY domain containing 1; fibronectin type 3 and SPRY domain-containing protein; fibronectin type III and SPRY domain containing 1; fibronectin type III and SPRY domain-containing protein 1; Fsd1; GLFND; Microtubule-associated protein GLFND; MID1-related protein 1; midline 1-related protein 1; MIR1; VLP27
Nom usuel FSD1
Symbole de gène(s) FSD1
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Marqueur de protéine His-ABP-tag
Séquence AVAGEFSEPVTLETPAFMFRLDASTSHQNLRVDDLSVEWDAMGGKVQDIKAREKDGKGRTASPINSPARGTPSPKRMPSGRGGRDRFTAE
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Pureté ou qualité >80% by SDS-PAGE and Coomassie blue staining
Afficher plus Afficher moins
Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis