missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human GBL (aa 149-230) Control Fragment Recombinant Protein

Code produit. 30206837
Click to view available options
Quantité:
100 μl
Conditionnement:
100µL
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Code produit. 30206837

Marque: Invitrogen™ RP102917

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

G-protein beta subunit like (GBL protein) is a novel member of WD-40 protein family. It is a highly conserved cytosolic protein consisting of seven WD-40 repeating motifs. LST8 is a functional component of mTOR signaling complex (TORC1) and positively up-regulates the mTOR pathway. It interacts with the kinase domain of mTOR and stabilizes its interaction with raptor. LST8 participates in regulating cell growth and also in nutrient and growth factor-mediated mTOR signaling to S6K1. Reports suggest up-regulated expression of LST8 due to insulin indicating a possible role of LST8 in intracellular events related to insulin-receptor activation including insulin-stimulated glucose transport and glycogen synthesis. Northern Blot analysis detected a ubiquitous expression of LST8 with highest expression in brain and testis.
TRUSTED_SUSTAINABILITY

Spécification

Numéro d’adhésion Q9BVC4
Concentration ≥5.0 mg/mL
À utiliser avec (application) Blocking Assay, Control
Formule 1 M urea, PBS with no preservative; pH 7.4
Identification génétique (Entrez) 64223
Nom Human GBL (aa 149-230) Control Fragment
Quantité 100 μl
État réglementaire RUO
Alias de gène 0610033N12Rik; AA409454; AI505104; AI851821; G beta-like protein; G protein beta subunit-like; Gable; GbetaL; GBL; GBL protein; Lst8; Mammalian lethal with SEC13 protein 8; mLST8; mLST8 / mLST8; MTOR associated protein, LST8 homolog; MTOR associated protein, LST8 homolog (S. cerevisiae); POP3; protein GbetaL; Target of rapamycin complex subunit LST8; TORC subunit gable; TORC subunit LST8; TORC subunit WAT1; transducin (beta)-like 4; WAT1
Nom usuel GBL
Symbole de gène(s) MLST8
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Marqueur de protéine His-ABP-tag
Séquence SGAIHIWDLKTDHNEQLIPEPEVSITSAHIDPDASYMAAVNSTGNCYVWNLTGGIGDEVTQLIPKTKIPAHTRYALQCRFSP
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Pureté ou qualité >80% by SDS-PAGE and Coomassie blue staining
Afficher plus Afficher moins
Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis