missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human Glutaminase (aa 617-668) Control Fragment Recombinant Protein

Code produit. 30212756
Click to view available options
Quantité:
100 μl
Conditionnement:
100µL
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Code produit. 30212756

Marque: Invitrogen™ RP96018

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83315 (PA5-83315. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Glutaminase is a phosphate-activated amidohydrolase that catalyzes the hydrolysis of glutamine to glutamate and ammonia. It is primarily expressed in the brain and kidney and plays an essential role in generating energy for metabolism, synthesizing neurotransmitter glutamate, and maintaing acid-based balance in the kidney. There are alternate splicing results in multiple transcript variants in the Glutaminase gene.
TRUSTED_SUSTAINABILITY

Spécification

Numéro d’adhésion O94925
Concentration ≥5.0 mg/mL
À utiliser avec (application) Blocking Assay, Control
Formule 1 M urea, PBS with no preservative; pH 7.4
Identification génétique (Entrez) 2744
Nom Human Glutaminase (aa 617-668) Control Fragment
Quantité 100 μl
État réglementaire RUO
Alias de gène 6330442B14; AAD20; AI314027; B230365M23Rik; DKFZp686O15119; FLJ10358; GA; GAC; GAM; GLS; GLS1; Glut; glutaminase; glutaminase C; glutaminase kidney isoform, mitochondrial; Glutaminase kidney isoform, mitochondrial 65 kDa chain; Glutaminase kidney isoform, mitochondrial 68 kDa chain; glutaminase, phosphate-activated; KGA; K-glutaminase; KIAA0838; L-glutamine amidohydrolase; PAG; phosphate-activated glutaminase; RATGLUT
Nom usuel Glutaminase
Symbole de gène(s) GLS
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Marqueur de protéine His-ABP-tag
Séquence DRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQTVHKNLDGL
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Pureté ou qualité >80% by SDS-PAGE and Coomassie blue staining
Afficher plus Afficher moins
Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis