missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human GNAZ (aa 75-224) Control Fragment Recombinant Protein

Code produit. 30194868
Click to view available options
Quantité:
100 μl
Conditionnement:
100µL
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Code produit. 30194868

Marque: Invitrogen™ RP91348

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82052 (PA5-82052. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

GNAZ is a member of a G protein subfamily that mediates signal transduction in pertussis toxin-insensitive systems. This protein may play a role in maintaining the ionic balance of perilymphatic and endolymphatic cochlear fluids.
TRUSTED_SUSTAINABILITY

Spécification

Numéro d’adhésion P19086
Concentration ≥5.0 mg/mL
À utiliser avec (application) Blocking Assay, Control
Formule 1 M urea, PBS with no preservative; pH 7.4
Identification génétique (Entrez) 2781
Nom Human GNAZ (aa 75-224) Control Fragment
Quantité 100 μl
État réglementaire RUO
Alias de gène AI847979; G protein subunit alpha z; g(x) alpha chain; GNAZ; guanine nucleotide binding protein (G protein), alpha z polypeptide; Guanine nucleotide binding protein alpha; guanine nucleotide binding protein, alpha z polypeptide; guanine nucleotide binding protein, alpha z subunit; guanine nucleotide-binding protein G(z) subunit alpha; GXA; Gz; Gz-alpha; transducin alpha
Nom usuel GNAZ
Symbole de gène(s) GNAZ
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Marqueur de protéine His-ABP-tag
Séquence YNAIDSLTRIIRALAALRIDFHNPDRAYDAVQLFALTGPAESKGEITPELLGVMRRLWADPGAQACFSRSSEYHLEDNAAYYLNDLERIAAADYIPTVEDILRSRDMTTGIVENKFTFKELTFKMVDVGGQRSERKKWIHCFEGVTAIIF
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Pureté ou qualité >80% by SDS-PAGE and Coomassie blue staining
Afficher plus Afficher moins
Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis