missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human GXYLT1 Control Fragment Recombinant Protein

Code produit. 30197395
Click to view available options
Quantité:
100 μl
Conditionnement:
100µL
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Code produit. 30197395

Marque: Invitrogen™ RP109919

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-145179 (PA5-145179. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Glycosyltransferase which elongates the O-linked glucose attached to EGF-like repeats in the extracellular domain of Notch proteins by catalyzing the addition of xylose.
TRUSTED_SUSTAINABILITY

Spécification

Numéro d’adhésion Q4G148
Concentration ≥5.0 mg/mL
À utiliser avec (application) Blocking Assay, Control
Formule 1 M urea, PBS with no preservative; pH 7.4
Identification génétique (Entrez) 283464
Nom Human GXYLT1 Control Fragment
Quantité 100 μl
État réglementaire RUO
Alias de gène 242n2; Glt8d3; glucoside xylosyltransferase 1; glycosyltransferase 8 domain containing 3; glycosyltransferase 8 domain-containing protein 3; Glycosyltransferase 8 domain-containing protein 3-like protein; Gm1228; Gm87; GXYLT1; S33-D
Nom usuel GXYLT1
Symbole de gène(s) GXYLT1
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Marqueur de protéine His-ABP-tag
Séquence VYEALRNCSFEDDNIRSLLKPLEPELQKTVHTYCGKIYKIFIKQLAKSVRDRFARS
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Pureté ou qualité >80% by SDS-PAGE and Coomassie blue staining
Afficher plus Afficher moins
Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis