missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Protéines recombinantes
  4. 30193738

Invitrogen™ Human HHATL (aa 150-250) Control Fragment Recombinant Protein

Code produit. 30193738
Click to view available options
Quantité:
100 μl
Conditionnement:
100µL
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Code produit. 30193738

Marque: Invitrogen™ RP90837

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53748 (PA5-53748. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

HHATL (Hedgehog Acyltransferase-Like) is a gene that codes for a protein involved in the regulation of Hedgehog signaling pathways. HHATL is located on chromosome 7q36.3. Structurally, the protein encoded by this gene is characterized by an acyltransferase domain, which plays a crucial role in the N-palmitoylation of the Sonic Hedgehog (Shh) protein, a process essential for its proper signaling activity and distribution. Functionally, HHATL has been implicated in various biological processes, including amelioration of endoplasmic reticulum stress through autophagy. The gene is expressed in several tissues, with notable high expression in the heart, suggesting a potential role in cardiac development and function. Dysfunction in HHATL could lead to anomalies in Hedgehog signaling, impacting various developmental and cellular processes.
TRUSTED_SUSTAINABILITY

Spécification

Numéro d’adhésion Q9HCP6
Concentration ≥5.0 mg/mL
À utiliser avec (application) Blocking Assay, Control
Formule 1 M urea, PBS with no preservative; pH 7.4
Identification génétique (Entrez) 57467
Nom Human HHATL (aa 150-250) Control Fragment
Quantité 100 μl
État réglementaire RUO
Alias de gène 1110011D13Rik; C3orf3; Glycerol uptake/transporter homolog; GUP1; GUP1 glycerol uptake/transporter homolog; Gup1, glycerol uptake/transporter homolog; hedgehog acyltransferase-like; hedgehog acyltransferase-like protein; HHATL; KIAA1173; MBOAT3; membrane bound O-acyltransferase domain containing 3; MSTP002; OACT3; Protein-cysteine N-palmitoyltransferase HHAT-like protein; RGD1311911
Nom usuel HHATL
Symbole de gène(s) HHATL
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Marqueur de protéine His-ABP-tag
Séquence ASFKMDPLISWQSGFVTGTFDLQEVLFHGGSSFTVLRCTSFALESCAHPDRHYSLADLLKYNFYLPFFFFGPIMTFDRFHAQVSQVEPVRREGELWHIRAQ
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Pureté ou qualité >80% by SDS-PAGE and Coomassie blue staining
Afficher plus Afficher moins
Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis