missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human HLA-DMB (aa 18-118) Control Fragment Recombinant Protein

Code produit. 30199099
Click to view available options
Quantité:
100 μl
Conditionnement:
100µL
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Code produit. 30199099

Marque: Invitrogen™ RP90111

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (70%), Rat (70%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52923 (PA5-52923. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

HLA-DMB (major histocompatibility complex, class II, DM beta), also known as D6S221E, RING7, HLA-DM histocompatibility type, beta chain, HLADMB or RING7, is a protein that in humans is encoded by the HLA-DMB gene. The HLA-DMB gene is mapped on 6p21.32. HLA-DMB belongs to the HLA class II beta chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DMA) and a beta (DMB) chain, both anchored in the membrane. It is located in intracellular vesicles. DM plays a central role in the peptide loading of MHC class II molecules by helping to release the CLIP (class II-associated invariant chain peptide) molecule from the peptide binding site. Class II molecules are expressed in antigen presenting cells. The beta chain is approximately 26-28 kDa and its gene contains 6 exons. HLA-DMA and -DMB appear to encode subunits of a functional heterodimer that is critical in the pathway of class II antigen presentation. HLA and MHC antibodies play a significant role in Immunopeptidomics, facilitating the identification and characterization of neoantigens through high-performance liquid chromatography coupled to tandem Mass Spectrometry.
TRUSTED_SUSTAINABILITY

Spécification

Numéro d’adhésion P28068
Concentration ≥5.0 mg/mL
À utiliser avec (application) Blocking Assay, Control
Formule 1 M urea, PBS with no preservative; pH 7.4
Identification génétique (Entrez) 3109
Nom Human HLA-DMB (aa 18-118) Control Fragment
Quantité 100 μl
État réglementaire RUO
Alias de gène class II histocompatibility antigen, M beta chain; D6S221E; DAAP-27A1.4; DMB; HLA class II histocompatibility antigen, DM beta chain; HLA-DMB; major histocompatibility complex, class II, DM beta; MHC class II antigen DMB; MHC class II antigen HLA-DM beta chain; MHC class II HLA-DMB; really interesting new gene 7 protein; RING7
Nom usuel HLA-DMB
Symbole de gène(s) HLA-DMB
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Marqueur de protéine His-ABP-tag
Séquence AGGFVAHVESTCLLDDAGTPKDFTYCISFNKDLLTCWDPEENKMAPCEFGVLNSLANVLSQHLNQKDTLMQRLRNGLQNCATHTQPFWGSLTNRTRPPSVQ
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Pureté ou qualité >80% by SDS-PAGE and Coomassie blue staining
Afficher plus Afficher moins
Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis