missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human HLA-DPB1 Control Fragment Recombinant Protein

Code produit. 30209235
Change view
Click to view available options
Quantité:
100 μl
Conditionnement:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit. Quantité unitSize
30209235 100 μl 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit. 30209235 Fournisseur Invitrogen™ Code fournisseur RP90436

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (69%), Rat (69%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82411 (PA5-82411. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

HLA-DPB belongs to the HLA class II beta chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DPA) and a beta chain (DPB), both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The beta chain is approximately 26-28 kDa and its gene contains 6 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail. Within the DP molecule both the alpha chain and the beta chain contain the polymorphisms specifying the peptide binding specificities, resulting in up to 4 different molecules. HLA and MHC antibodies play a significant role in Immunopeptidomics, facilitating the identification and characterization of neoantigens through high-performance liquid chromatography coupled to tandem Mass Spectrometry.
TRUSTED_SUSTAINABILITY

Spécification

Numéro d’adhésion P04440
Concentration ≥5.0 mg/mL
À utiliser avec (application) Blocking Assay, Control
Formule 1 M urea, PBS with no preservative; pH 7.4
Identification génétique (Entrez) 3115
Nom Human HLA-DPB1 Control Fragment
Quantité 100 μl
État réglementaire RUO
Alias de gène beta1 domain MHC class II HLA DPB; CD; CELIAC1; class II HLA beta chain; DC-1 alpha chain; DC-alpha; DPB1; DQ-A1; GSE; histocompatibility antigen HLA-DR alpha; HLA class II histocompatibility antigen, DP beta 1 chain; HLA class II histocompatibility antigen, DP(W4) beta chain; HLA class II histocompatibility antigen, DQ alpha 1 chain; HLA class II histocompatibility antigen, DQ(W3) alpha chain; HLA class II histocompatibility antigen, DR alpha chain; HLA DP14-beta chain; HLA-DCA; HLA-DP; HLA-DP histocompatibility type, beta-1 subunit; HLA-DP1B; HLA-DPB; HLA-DPB1; HLA-DQA; HLA-DQA1; HLA-DRA; HLA-DRA1; leucocyte antigen DQA1; leukocyte antigen alpha chain; major histocompatibility complex class II antigen beta chain; major histocompatibility complex, class II, DP beta 1; major histocompatibility complex, class II, DQ alpha 1; major histocompatibility complex, class II, DR alpha; MHC cell surface glycoprotein; MHC cla; MHC class II antigen; MHC class II antigen beta chain; MHC class II antigen DP beta 1 chain; MHC class II antigen DPB1; MHC class II antigen DPbeta1; MHC class II antigen DRA; MHC class II DQA1; MHC class II HLA-D alpha glycoprotein; MHC class II HLA-DP-beta-1; MHC class II HLA-DQ-alpha-1; MHC class II HLA-DRB1; MHC class II surface glycoprotein; MHC HLA DPB1; MHC HLA-DQ alpha; MLRW
Nom usuel HLA-DPB1
Symbole de gène(s) HLA-DPB1
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Marqueur de protéine His-ABP-tag
Séquence YNREEFVRFDSDVGEFRAVTELGRPDEEYWNSQKDILEEKRAVPDRMCRHNYELGGPMTLQRRVQPRVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDWTF
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Pureté ou qualité >80% by SDS-PAGE and Coomassie blue staining
Afficher plus Afficher moins
Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.