missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Protéines recombinantes
  4. 30210350

Invitrogen™ Human HOXD13 (aa 191-261) Control Fragment Recombinant Protein

Code produit. 30210350
Click to view available options
Quantité:
100 μl
Conditionnement:
100µL
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Code produit. 30210350

Marque: Invitrogen™ RP107309

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66661 (PA5-66661. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

HOXD13 (homeobox protein D13) belongs to a class of transcription factors called homeobox proteins. In vertebrates, homeobox are found in clusters called A, B, C, and D on four separate chromosomes. Expression of homeobox proteins is spatially and temporally regulated during embryonic development. The gene encoding HOXD13 is part of the D cluster on chromosome 2. Deletions that remove the entire HOXD gene cluster or the 5' end of this cluster have been associated with severe limb and genital abnormalities. Mutations in the HOXD13 gene cause synpolydactyly.
TRUSTED_SUSTAINABILITY

Spécification

Numéro d’adhésion P35453
Concentration ≥5.0 mg/mL
À utiliser avec (application) Blocking Assay, Control
Formule 1 M urea, PBS with no preservative; pH 7.4
Identification génétique (Entrez) 3239
Nom Human HOXD13 (aa 191-261) Control Fragment
Quantité 100 μl
État réglementaire RUO
Alias de gène BDE; BDSD; homeo box 4 I; homeo box D13; homeobox D13; homeobox protein Hox-4.8; Homeobox protein Hox-4 I; homeobox protein Hox-D13; Hox-4.8; HO x 4 I; Hoxd13; SPD; SPD1; spdh
Nom usuel HOXD13
Symbole de gène(s) HOXD13
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Marqueur de protéine His-ABP-tag
Séquence SFYQGYTSPYQHVPGYIDMVSTFGSGEPRHEAYISMEGYQSWTLANGWNSQVYCTKDQPQGSHFWKSSFPG
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Pureté ou qualité >80% by SDS-PAGE and Coomassie blue staining
Afficher plus Afficher moins
Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis