missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Protéines recombinantes
  4. 30199209

Invitrogen™ Human ID2 (aa 62-134) Control Fragment Recombinant Protein

Code produit. 30199209
Click to view available options
Quantité:
100 μl
Conditionnement:
100µL
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Code produit. 30199209

Marque: Invitrogen™ RP95279

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The inhibitor of DNA binding 2 (ID2) protein is essential for promoting the development of a number of cell types including natural killer cell, erythroid precursors, as well as, CD8+ and CD4+ T-cell. A lack of ID2 promotes B-cell development. The chief role of this protein is to associate with ubiquitously-expressed E proteins, and other proteins of the basic helix-loop-helix (HLH) family, preventing them from binding to DNA and activating transcription. Activation of ID2 is critical for the development of the natural killer cell lineage.
TRUSTED_SUSTAINABILITY

Spécification

Numéro d’adhésion Q02363
Concentration ≥5.0 mg/mL
À utiliser avec (application) Blocking Assay, Control
Formule 1 M urea, PBS with no preservative; pH 7.4
Identification génétique (Entrez) 3398
Nom Human ID2 (aa 62-134) Control Fragment
Quantité 100 μl
État réglementaire RUO
Alias de gène Ac2-300; AI255428; bHLHb26; C78922; cell growth-inhibiting gene 8; class B basic helix-loop-helix protein 26; DNA-binding protein inhibitor ID2; DNA-binding protein inhibitor ID-2; GIG8; helix-loop-helix protein ID2; Id2; Id-2; ID2A; ID2H; Idb2; Inhibitor of differentiation 2; inhibitor of DNA binding 2; inhibitor of DNA binding 2, dominant negative helix-loop-helix protein; inhibitor of DNA binding 2, HLH protein; MGC26389; OTTHUMP00000140258; OTTHUMP00000200297
Nom usuel ID2
Symbole de gène(s) ID2
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Marqueur de protéine His-ABP-tag
Séquence MEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALCG
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Pureté ou qualité >80% by SDS-PAGE and Coomassie blue staining
Afficher plus Afficher moins
Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis