missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Protéines recombinantes
  4. 30200084

Invitrogen™ Human Lamin B1 (aa 410-491) Control Fragment Recombinant Protein

Code produit. 30200084
Click to view available options
Quantité:
100 μl
Conditionnement:
100µL
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Code produit. 30200084

Marque: Invitrogen™ RP103972

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Laminins, a family of extracellular matrix glycoproteins, are the major noncollagenous constituent of basement membranes. They have been implicated in a wide variety of biological processes including cell adhesion, differentiation, migration, signaling, neurite outgrowth and metastasis. Laminins are composed of 3 non identical chains: laminin alpha, beta and gamma (formerly A, B1, and B2, respectively) and they form a cruciform structure consisting of 3 short arms, each formed by a different chain, and a long arm composed of all 3 chains. Defects in the LMNB1 gene can cause Leukodystrophy, demyelinating, autosomal dominant, adult-onset (ADLD).
TRUSTED_SUSTAINABILITY

Spécification

Numéro d’adhésion P20700
Concentration ≥5.0 mg/mL
À utiliser avec (application) Blocking Assay, Control
Formule 1 M urea, PBS with no preservative; pH 7.4
Identification génétique (Entrez) 4001
Nom Human Lamin B1 (aa 410-491) Control Fragment
Quantité 100 μl
État réglementaire RUO
Alias de gène 0710005A05Rik; ADLD; C-flanking peptide of NPY; CPON; fc06g01; I79_003938; lamin B1; lamin B1 L homeolog; lamin B1 protein; lamin-b; lamin-B1; Lamin-L(I); LMN; LMN2; LMNB; LMNB1; lmnb1 protein; lmnb1.L; MGC111419; Neuropeptide tyrosine; Neuropeptide Y; NPY; NPY02; prepro-neuropeptide Y; pro-neuropeptide Y; PYY4; RATNPY; RATNPY02; unnamed protein product; wu:fc06g01; XELAEV_18007951mg
Nom usuel Lamin B1
Symbole de gène(s) Lmnb1
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Marqueur de protéine His-ABP-tag
Séquence RTTRGKRKRVDVEESEASSSVSISHSASATGNVCIEEIDVDGKFIRLKNTSEQDQPMGGWEMIRKIGDTSVSYKYTSRYVLK
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Pureté ou qualité >80% by SDS-PAGE and Coomassie blue staining
Afficher plus Afficher moins
Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis