missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Protéines recombinantes
  4. 30209058

Invitrogen™ Human MAP2 (aa 1540-1674) Control Fragment Recombinant Protein

Code produit. 30209058
Click to view available options
Quantité:
100 μl
Conditionnement:
100µL
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Code produit. 30209058

Marque: Invitrogen™ RP89887

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110744 (PA5-110744. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MAP2 (Microtubule Associated Protein 2) exists in two high molecular weight forms (MAP2a & MAP2b) and a low molecular weight form. The expression of MAP2 is developmentally regulated and its multiple forms arise by alternative splicing of a single gene. MAP2 is involved in microtubule assembly, which is an essential step in neurogenesis. The products of similar genes in rat and mouse are neuron-specific cytoskeletal proteins that are enriched in dendrites, implicating a role in determining and stabilizing dendritic shape during neuron development. MAP2 is useful in studies of neuron structure in normal and malignant brain tissue as well as in degenerative diseases such as Alzheimer's Disease (AD).
TRUSTED_SUSTAINABILITY

Spécification

Numéro d’adhésion P11137
Concentration ≥5.0 mg/mL
À utiliser avec (application) Blocking Assay, Control
Formule 1 M urea, PBS with no preservative; pH 7.4
Identification génétique (Entrez) 4133
Nom Human MAP2 (aa 1540-1674) Control Fragment
Quantité 100 μl
État réglementaire RUO
Alias de gène a730034c02; AC091465.1; DKFZp686I2148; G1-397-34; MAP 2; Map2; MAP-2; map2.S; map2a; map-2 A; map2ab; MAP2B; MAP2C; MAP2R; microtubule associated protein 2; microtubule associated protein 2 S homeolog; microtubule associated protein 2; microtubule-associated protein 2; microtubule associated protein 2 C; microtubule-associated protein 2; microtubule-associated protein-2; Mtap2; Mtap-2; OTTHUMP00000163916; OTTHUMP00000208143; repro4; XELAEV_18047318mg; xmap2
Nom usuel MAP2
Symbole de gène(s) Map2
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Marqueur de protéine His-ABP-tag
Séquence SLPRPSSILPPRRGVSGDRDENSFSLNSSISSSARRTTRSEPIRRAGKSGTSTPTTPGSTAITPGTPPSYSSRTPGTPGTPSYPRTPHTPGTPKSAILVPSEKKVAIIRTPPKSPATPKQLRLINQPLPDLKNVK
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Pureté ou qualité >80% by SDS-PAGE and Coomassie blue staining
Afficher plus Afficher moins
Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis