missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human MAVS (aa 415-500) Control Fragment Recombinant Protein

Code produit. 30212491
Click to view available options
Quantité:
100 μl
Conditionnement:
100µL
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Code produit. 30212491

Marque: Invitrogen™ RP103160

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (52%), Rat (52%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84160 (PA5-84160. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Two distinct signaling pathways activate the host innate immunity against viral infection. One pathway is reliant on members of the Toll-like receptor (TLR) family while the other uses the RNA helicase RIG-I as a receptor for intracellular viral double-stranded RNA as a trigger for the immune response. MAVS is a mitochondrial membrane protein that was identified as a critical component in the IFN beta signaling pathways that recruits IRF-3 to RIG-I, leading to its activation and that of NF-kappa-B. MAVS is also thought to interact with other components of the innate immune pathway such as the TLR adapter protein TRIF, TRAF2 and TRAF6. MAVS also interacts with the IKK-alpha, IKK-beta and IKK-iota kinases through its C-terminal region. Cleavage of this region by the Hepatitis C virus (HCV) protease allows HCV to escape the host immune system. Multiple isoforms of MAVS are known to exist.
TRUSTED_SUSTAINABILITY

Spécification

Numéro d’adhésion Q7Z434
Concentration ≥5.0 mg/mL
À utiliser avec (application) Blocking Assay, Control
Formule 1 M urea, PBS with no preservative; pH 7.4
Identification génétique (Entrez) 57506
Nom Human MAVS (aa 415-500) Control Fragment
Quantité 100 μl
État réglementaire RUO
Alias de gène CARD adapter inducing interferon beta; CARD adaptor inducing IFN-beta; Cardif; D430028G21Rik; IFN-B promoter stimulator 1; IFN-beta promoter stimulator-1; interferon beta promoter stimulator protein 1; interferon-beta promoter stimulator protein 1; IPS1; IPS-1; KIAA1271; MAVS; mitochondrial antiviral signaling protein; mitochondrial anti-viral signaling protein; mitochondrial antiviral-signaling protein; Putative NF-kappa-B-activating protein 031 N; virus-induced signaling adapter; virus-induced signaling adaptor; virus-induced-signaling adapter; VISA
Nom usuel MAVS
Symbole de gène(s) MAVS
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Marqueur de protéine His-ABP-tag
Séquence GSELSKPGVLASQVDSPFSGCFEDLAISASTSLGMGPCHGPEENEYKSEGTFGIHVAENPSIQLLEGNPGPPADPDGGPRPQADRK
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Pureté ou qualité >80% by SDS-PAGE and Coomassie blue staining
Afficher plus Afficher moins
Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis