missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Protéines recombinantes
  4. 30200813

Invitrogen™ Human METTL1 (aa 207-276) Control Fragment Recombinant Protein

Code produit. 30200813
Click to view available options
Quantité:
100 μl
Conditionnement:
100µL
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Code produit. 30200813

Marque: Invitrogen™ RP92501

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54280 (PA5-54280. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene is similar in sequence to the S. cerevisiae YDL201w gene. The gene product contains a conserved S-adenosylmethionine-binding motif and is inactivated by phosphorylation.
TRUSTED_SUSTAINABILITY

Spécification

Numéro d’adhésion Q9UBP6
Concentration ≥5.0 mg/mL
À utiliser avec (application) Blocking Assay, Control
Formule 1 M urea, PBS with no preservative; pH 7.4
Identification génétique (Entrez) 4234
Nom Human METTL1 (aa 207-276) Control Fragment
Quantité 100 μl
État réglementaire RUO
Alias de gène 2810012D02Rik; C12orf1; D1075-like gene product; hypothetical protein LOC449779; methyltransferase like 1; methyltransferase-like 1; methyltransferase-like protein 1; METTL1; miRNA (guanine-N(7)-)-methyltransferase; mRNA (guanine-N(7)-)-methyltransferase; TRM8; TRMT8; tRNA (guanine(46)-N(7))-methyltransferase; tRNA (guanine-N(7)-)-methyltransferase; tRNA (guanine-N(7)-)-methyltransferase-like protein; tRNA(m7G46)-methyltransferase; Unknown (protein for MGC:134433); YDL201w; zgc:103636
Nom usuel METTL1
Symbole de gène(s) Mettl1
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Marqueur de protéine His-ABP-tag
Séquence MCTHFEEHPLFERVPLEDLSEDPVVGHLGTSTEEGKKVLRNGGKNFPAIFRRIQDPVLQAVTSQTSLPGH
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Pureté ou qualité >80% by SDS-PAGE and Coomassie blue staining
Afficher plus Afficher moins
Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis