missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human MKP-1 (aa 311-359) Control Fragment Recombinant Protein

Code produit. 30199833
Click to view available options
Quantité:
100 μl
Conditionnement:
100µL
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Code produit. 30199833

Marque: Invitrogen™ RP105479

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84818 (PA5-84818. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The expression of DUSP1 gene is induced in human skin fibroblasts by oxidative/heat stress and growth factors. It specifies a protein with structural features similar to members of the non-receptor-type protein-tyrosine phosphatase family, and which has significant amino-acid sequence similarity to a Tyr/Ser-protein phosphatase encoded by the late gene H1 of vaccinia virus. The bacterially expressed and purified DUSP1 protein has intrinsic phosphatase activity, and specifically inactivates mitogen-activated protein (MAP) kinase in vitro by the concomitant dephosphorylation of both its phosphothreonine and phosphotyrosine residues. Furthermore, it suppresses the activation of MAP kinase by oncogenic ras in extracts of Xenopus oocytes. Thus, DUSP1 may play an important role in the human cellular response to environmental stress as well as in the negative regulation of cellular proliferation.
TRUSTED_SUSTAINABILITY

Spécification

Numéro d’adhésion P28562
Concentration ≥5.0 mg/mL
À utiliser avec (application) Blocking Assay, Control
Formule 1 M urea, PBS with no preservative; pH 7.4
Identification génétique (Entrez) 1843
Nom Human MKP-1 (aa 311-359) Control Fragment
Quantité 100 μl
État réglementaire RUO
Alias de gène 3 ch134; 3 CH134/CL100 PTPase; CL 100; CL100; dual specificity phosphatase 1; dual specificity protein phosphatase 1; Dual specificity protein phosphatase hVH1; DUS1; DUSP1; EC 3.1.3.16; EC 3.1.3.48; erp; HVH1; MAP kinase phosphatase 1; MAP kinase phosphatase-1; mitogen-activated protein (MAP) kinase phosphatase-1; mitogen-activated protein kinase phosphatase 1; mitogen-activated protein kinase phosphatase-1; MKP1; mkp-1; oxidative stress-inducible protein tyrosine phosphatase; protein tyrosine phosphatase non-receptor type 16; protein tyrosine phosphatase, non-receptor type 16; protein-tyrosine phosphatase 3 CH134; Protein-tyrosine phosphatase CL100; protein-tyrosine phosphatase ERP; Protein-tyrosine phosphatase non-receptor type 16; PTPN10; Ptpn16; serine/threonine specific protein phosphatase; U19515; VH1
Nom usuel MKP-1
Symbole de gène(s) Dusp1
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Marqueur de protéine His-ABP-tag
Séquence QVLAPHCSAEAGSPAMAVLDRGTSTTTVFNFPVSIPVHSTNSALSYLQS
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Pureté ou qualité >80% by SDS-PAGE and Coomassie blue staining
Afficher plus Afficher moins
Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis