missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Protéines recombinantes
  4. 30202972

Invitrogen™ Human MRS2 (aa 198-326) Control Fragment Recombinant Protein

Code produit. 30202972
Click to view available options
Quantité:
100 μl
Conditionnement:
100µL
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Code produit. 30202972

Marque: Invitrogen™ RP90946

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53616 (PA5-53616. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Mrs2 is a magnesium transporter that mediates the influx of magnesium into the mitochondrial matrix. Mrs2 is required for normal expression of the mitochondrial respiratory complex I subunits, and mediates the influx of magnesium into the mitochondrial matrix. Mrs2 is also required for normal expression of the mitochondrial respiratory complex I subunits.
TRUSTED_SUSTAINABILITY

Specifications

Numéro d’adhésion Q9HD23
Concentration ≥5.0 mg/mL
À utiliser avec (application) Blocking Assay, Control
Formule 1 M urea, PBS with no preservative; pH 7.4
Identification génétique (Entrez) 57380
Nom Human MRS2 (aa 198-326) Control Fragment
Quantité 100 μl
État réglementaire RUO
Alias de gène Gm902; HPT; Magnesium transporter MRS2 homolog, mitochondrial; MRS2; MRS2 magnesium homeostasis factor homolog; MRS2 magnesium homeostasis factor homolog (S. cerevisiae); MRS2 magnesium transporter; MRS2, magnesium transporter; MRS2L; MRS2-like protein; MRS2-like, magnesium homeostasis factor; putative magnesium transporter; RPT; RPT protein similar to yeast MRS2
Nom usuel MRS2
Symbole de gène(s) MRS2
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Marqueur de protéine His-ABP-tag
Séquence NTLQGKLSILQPLILETLDALVDPKHSSVDRSKLHILLQNGKSLSELETDIKIFKESILEILDEEELLEELCVSKWSDPQVFEKSSAGIDHAEEMELLLENYYRLADDLSNAARELRVLIDDSQSIIFI
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Pureté ou qualité >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.