missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Protéines recombinantes
  4. 30197985

Invitrogen™ Human NEDD4L (aa 160-194) Control Fragment Recombinant Protein

Code produit. 30197985
Click to view available options
Quantité:
100 μl
Conditionnement:
100µL
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Code produit. 30197985

Marque: Invitrogen™ RP105336

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66713 (PA5-66713. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NEDD4L is an E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. NEDD4L inhibits TGF-beta signaling by triggering SMAD2 and TGFR1 ubiquitination and proteasome-dependent degradation. NEDD4L promotes ubiquitination and internalization of various plasma membrane channels such as ENaC, Nav1.2, Nav1.3, Nav1.5, Nav1.7, Nav1.8, Kv1.3, EAAT1 or CLC5. NEDD4L also promotes ubiquitination and degradation of SGK.
TRUSTED_SUSTAINABILITY

Spécification

Numéro d’adhésion Q96PU5
Concentration ≥5.0 mg/mL
À utiliser avec (application) Blocking Assay, Control
Formule 1 M urea, PBS with no preservative; pH 7.4
Identification génétique (Entrez) 23327
Nom Human NEDD4L (aa 160-194) Control Fragment
Quantité 100 μl
État réglementaire RUO
Alias de gène 1300012C07Rik; E3 ubiquitin-protein ligase NEDD4-like; FLJ33870; HECT-type E3 ubiquitin transferase NED4L; hNEDD4-2; KIAA0439; NEDD4; NEDD4 like E3 ubiquitin protein ligase; NEDD4.2; Nedd4-2; nedd4b; NEDD4L; NEDL3; neural precursor cell expressed, developmentally down-regulated 4-like, E3 ubiquitin protein ligase; neural precursor cell expressed, developmentally down-regulated gene 4 b; neural precursor cell expressed, developmentally down-regulated gene 4-like; RSP5; ubiquitin-protein ligase Nedd4-2; ubiquitin-protein ligase Rsp5; Unknown (protein for IMAGE:7986262)
Nom usuel NEDD4L
Symbole de gène(s) NEDD4L
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Marqueur de protéine His-ABP-tag
Séquence DEENSDQRDDMEHGWEVVDSNDSASQHQEELPPPP
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Pureté ou qualité >80% by SDS-PAGE and Coomassie blue staining
Afficher plus Afficher moins
Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis