missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human PHLDA1 (aa 246-307) Control Fragment Recombinant Protein

Code produit. 30198065
Click to view available options
Quantité:
100 μl
Conditionnement:
100µL
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Code produit. 30198065

Marque: Invitrogen™ RP107243

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84598 (PA5-84598. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Cytotoxic T lymphocyte (CTL)-mediated cytotoxicity constitutes an important component of specific effector mechanisms in immunosurveillance against virus-infected or -transformed cells. Two mechanisms appear to account for this activity, one of which is the perforin-based process. Independently, a FAS-based mechanism involves the transducing molecule FAS (APO-1) and its ligand (FAS-L). The human FAS (APO-1) protein is a 48 kDa cell surface glycoprotein that belongs to a family of receptors that includes CD40, nerve growth factor receptors and tumor necrosis factor receptors. The FAS antigen is expressed on a broad range of lymphoid cell lines, and is expressed at high levels in T cells subsequent to crosslinking of the T cell receptor (TCR). A previously undescribed protein, TDAG51, restores activation- induced apoptosis in cells that have lost the ability to display Fas in response to activation.
TRUSTED_SUSTAINABILITY

Spécification

Numéro d’adhésion Q8WV24
Concentration ≥5.0 mg/mL
À utiliser avec (application) Blocking Assay, Control
Formule 1 M urea, PBS with no preservative; pH 7.4
Identification génétique (Entrez) 22822
Nom Human PHLDA1 (aa 246-307) Control Fragment
Quantité 100 μl
État réglementaire RUO
Alias de gène apoptosis-associated nuclear protein; DT1P1B11; PHLDA1; PHRIP; pleckstrin homology like domain family A member 1; pleckstrin homology-like domain family A member 1; pleckstrin homology-like domain, family A, member 1; PQR protein; PQ-rich protein; proline- and glutamine-rich protein; Proline- and histidine-rich protein; proline-histidine rich protein; T-cell death associated; T-cell death-associated gene 51 protein; Tdag; TDAG51
Nom usuel PHLDA1
Symbole de gène(s) PHLDA1
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Marqueur de protéine His-ABP-tag
Séquence KGKYMYFTVVMAEGKEIDFRCPQDQGWNAEITLQMVQYKNRQAILAVKSTRQKQQHLVQQQP
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Pureté ou qualité >80% by SDS-PAGE and Coomassie blue staining
Afficher plus Afficher moins
Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis