missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Protéines recombinantes
  4. 30193783

Invitrogen™ Human PRUNE2 (aa 2298-2437) Control Fragment Recombinant Protein

Code produit. 30193783
Click to view available options
Quantité:
100 μl
Conditionnement:
100µL
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Code produit. 30193783

Marque: Invitrogen™ RP110173

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-144721 (PA5-144721. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PRUNE2 gene, also named BMCC1, encodes protein prune homolog 2. PRUNE2 gene are overlapping with PCA3, one of the most prostate cancer specific markers. PRUNE2 may play an important role in regulating differentiation, survival and aggressiveness of the tumor cells. Besides its high level of expression seen in the nervous system (brain, cerebellum and spinal cord), it is also expressed at high levels in noneuroblastoma, rhabdomyosarcoma, melanoma and some osteosarcoma cell lines, whereas at only low levels in cancer cell lines of liver, breast, thyroid and colon. The Calculated molecular weight of this protein is 340 kDa.
TRUSTED_SUSTAINABILITY

Spécification

Numéro d’adhésion Q8WUY3
Concentration ≥5.0 mg/mL
À utiliser avec (application) Blocking Assay, Control
Formule 1 M urea, PBS with no preservative; pH 7.4
Identification génétique (Entrez) 158471
Nom Human PRUNE2 (aa 2298-2437) Control Fragment
Quantité 100 μl
État réglementaire RUO
Alias de gène 6330414G02Rik; A214N16.3; A230083H22Rik; A330102H22Rik; bA214N16.3; BCH motif-containing molecule at the carboxyl terminal region 1; Bmcc1; BNIP2 motif containing molecule at the carboxyl terminal region 1; BNIP2 motif-containing molecule at the C-terminal region 1; BNIPXL; C9orf65; DKFZp762K117; KIAA0367; mKIAA0367; neuronal protein; olfaxin; protein prune homolog 2; prune homolog 2; prune homolog 2 (Drosophila); PRUNE2; RGD1311350; RP11-214N16.3; RP11-58J3.2; truncated PRUNE2
Nom usuel PRUNE2
Symbole de gène(s) PRUNE2
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Marqueur de protéine His-ABP-tag
Séquence AFDHSFSDASGLNTSTGTIDDMSKLTLSEGHPETPVDGDLGKQDICSSEASWGDFEYDVMGQNIDEDLLREPEHFLYGGDPPLEEDSLKQSLAPYTPPFDLSYLTEPAQSAETIEEAGSPEDESLGCRAAEIVLSALPDR
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Pureté ou qualité >80% by SDS-PAGE and Coomassie blue staining
Afficher plus Afficher moins
Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis