missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human RIG-I (aa 501-635) Control Fragment Recombinant Protein

Code produit. 30205233
Click to view available options
Quantité:
100 μl
Conditionnement:
100µL
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Code produit. 30205233

Marque: Invitrogen™ RP104832

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111253 (PA5-111253. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Retinoic acid-inducible gene I, RIG-I is a pattern recognition receptor (PRR) involved in the recognition of viral dsRNA. Along with MDA5, RIG-I detects viral dsRNA and activates the innate immune response. Both MDA5 and RIG-I are RNA helicases and they perform overlapping as well as distinct roles. RIG-I is activated by dsRNAs without a 5'-triphosphate end and short dsRNAs, whereas MDA5 is activated by long dsRNAs. Once activated, both proteins signal through IPS-1 activating transcription factors NF-kappaB and IRF-3 (1) and ultimately activating apoptosis, cytokine signaling, and inflammation. RIG-I is essential for signaling by influenza A, influenza B, human respiratory syncytial virus (3), paromyxoviruses, Japanese encephalitis virus, and West Nile virus. MicroRNA-146a has been implicated in feedback inhibition of RIG-I-dependant antiviral response by negatively regulating RIG-I targets TRAF6, IRAK1, and IRAK2. Recent evidence has implicated RIG-I in the detection of cytosolic DNA through RNA polymerase III activity.
TRUSTED_SUSTAINABILITY

Spécification

Numéro d’adhésion O95786
Concentration ≥5.0 mg/mL
À utiliser avec (application) Blocking Assay, Control
Formule 1 M urea, PBS with no preservative; pH 7.4
Identification génétique (Entrez) 23586
Nom Human RIG-I (aa 501-635) Control Fragment
Quantité 100 μl
État réglementaire RUO
Alias de gène 6430573D20Rik; C330021E21; Dd x 58; DEAD (Asp-Glu-Ala-Asp) box polypeptide 58; DEAD box protein 58; DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide; DEAD/H box polypeptide RIG-I; DEAD-box protein 58; DEXD/H-box helicase 58; probable ATP-dependent RNA helicase DD x 58; Retinoic acid-inducible gene 1 protein; retinoic acid-inducible gene I protein; retinoic acid-inducible gene-I; RIG-1; RIGI; RIG-I; RIG-I-like receptor 1; RLR-1; RNA helicase RIG-I; SGMRT2
Nom usuel RIG-I
Symbole de gène(s) DDX58
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Marqueur de protéine His-ABP-tag
Séquence NREFGTQKYEQWIVTVQKACMVFQMPDKDEESRICKALFLYTSHLRKYNDALIISEHARMKDALDYLKDFFSNVRAAGFDEIEQDLTQRFEEKLQELESVSRDPSNENPKLEDLCFILQEEYHLNPETITILFVK
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Pureté ou qualité >80% by SDS-PAGE and Coomassie blue staining
Afficher plus Afficher moins
Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis