missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Protéines recombinantes
  4. 30207114

Invitrogen™ Human STRN3 (aa 204-342) Control Fragment Recombinant Protein

Code produit. 30207114
Click to view available options
Quantité:
100 μl
Conditionnement:
100µL
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Code produit. 30207114

Marque: Invitrogen™ RP89110

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52085 (PA5-52085. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SG2NA was identified as a human cancer autoantigen and has now been implicated in vesicular trafficking and signal transduction. It is highly related to striatin and zinedin. It is a scaffolding protein that binds PP2A A and C subunits as well as the human homolog of the yeast protein, Mob1, which has been implicated in control of mitotic progression in yeast. It also binds calmodulin and appears to modulate PP2A activity.
TRUSTED_SUSTAINABILITY

Spécification

Numéro d’adhésion Q13033
Concentration ≥5.0 mg/mL
À utiliser avec (application) Blocking Assay, Control
Formule 1 M urea, PBS with no preservative; pH 7.4
Identification génétique (Entrez) 29966
Nom Human STRN3 (aa 204-342) Control Fragment
Quantité 100 μl
État réglementaire RUO
Alias de gène Cell cycle autoantigen SG2NA; cell cycle S/G2 nuclear autoantigen; cell-cycle autoantigen SG2NA; Gs2na; nuclear autoantigen; PPP2R6B; protein phosphatase 2 regulatory subunit B'''beta; s/G2 antigen; Sg2na; SG2NA beta isoform; striatin 3; striatin, calmodulin binding protein 3; striatin-3; striatin-3 35 kDa; striatin-3-gamma; Strn3
Nom usuel STRN3
Symbole de gène(s) STRN3
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Marqueur de protéine His-ABP-tag
Séquence LGLSNSEPNGSVETKNLEQILNGGESPKQKGQEIKRSSGDVLETFNFLENADDSDEDEENDMIEGIPEGKDKHRMNKHKIGNEGLAADLTDDPDTEEALKEFDFLVTAEDGEGAGEARSSGDGTEWAEPITFPSGGGKS
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Pureté ou qualité >80% by SDS-PAGE and Coomassie blue staining
Afficher plus Afficher moins
Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis