missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Protéines recombinantes
  4. 30203569

Invitrogen™ Human TdT (aa 356-440) Control Fragment Recombinant Protein

Code produit. 30203569
Click to view available options
Quantité:
100 μl
Conditionnement:
100µL
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Code produit. 30203569

Marque: Invitrogen™ RP108819

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (68%), Rat (68%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Terminal Deoxynucleotidyl Transferase (TdT) is a DNA polymerase located in the cell nucleus which catalyses the polymerization of deoxynucleotides at the 3' hydroxyl ends of oligo or polydeoxynucleotide initiators and functions without a template. TdT is considered to be a highly specific marker for the diagnosis and classification of acute lymphoblastic lymphoma/leuksemias. The determination of TdT expression is most valuable when it is different to differentiate histologically between lymphoblastic lymphoma and Burkitt's lymphoma.
TRUSTED_SUSTAINABILITY

Spécification

Numéro d’adhésion P04053
Concentration ≥5.0 mg/mL
À utiliser avec (application) Blocking Assay, Control
Formule 1 M urea, PBS with no preservative; pH 7.4
Identification génétique (Entrez) 1791
Nom Human TdT (aa 356-440) Control Fragment
Quantité 100 μl
État réglementaire RUO
Alias de gène Deoxynucleotidyltransferase terminal; deoxynucleotidyltransferase, terminal; DNA nucleotidylexotransferase; Dntt; Nucleosidetriphosphate DNA Deoxynucleotidylexotransferase; nucleosidetriphosphate:DNA deoxynucleotidylexotransferase; TDT; Terminal addition enzyme; terminal deoxynucleotidyl transferase; terminal deoxynucleotidyltransferase; terminal deoxyribonucleotidyltransferase; terminal transferase
Nom usuel TdT
Symbole de gène(s) DNTT
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Marqueur de protéine His-ABP-tag
Séquence DEEQLLQKVMNLWEKKGLLLYYDLVESTFEKLRLPSRKVDALDHFQKCFLIFKLPRQRVDSDQSSWQEGKTWKAIRVDLVLCPYE
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Pureté ou qualité >80% by SDS-PAGE and Coomassie blue staining
Afficher plus Afficher moins
Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis