missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human TFB2M (aa 21-84) Control Fragment Recombinant Protein

Code produit. 30197368
Click to view available options
Quantité:
100 μl
Conditionnement:
100µL
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Code produit. 30197368

Marque: Invitrogen™ RP104590

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (34%), Rat (34%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65026 (PA5-65026. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

S-adenosyl-L-methionine-dependent methyltransferase which specifically dimethylates mitochondrial 12S rRNA at the conserved stem loop. Also required for basal transcription of mitochondrial DNA, probably via its interaction with POLRMT and TFAM. Stimulates transcription independently of the methyltransferase activity. Compared to TFB1M, it activates transcription of mitochondrial DNA more efficiently, while it has less methyltransferase activity.
TRUSTED_SUSTAINABILITY

Spécification

Numéro d’adhésion Q9H5Q4
Concentration ≥5.0 mg/mL
À utiliser avec (application) Blocking Assay, Control
Formule 1 M urea, PBS with no preservative; pH 7.4
Identification génétique (Entrez) 64216
Nom Human TFB2M (aa 21-84) Control Fragment
Quantité 100 μl
État réglementaire RUO
Alias de gène dimethyladenosine transferase 2, mitochondrial; FLJ22661; FLJ23182; HCV NS5A-transactivated protein 5; Hepatitis C virus NS5A-transactivated protein 5; Hkp1; h-mtTFB; h-mtTFB2; house-keeping protein 1; hTFB2M; mitochondrial 12 S rRNA dimethylase 2; Mitochondrial transcription factor B2; mTFB2M; mtTFB2; NS5ATP5; S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase 2; TFB2M; transcription factor B2, mitochondrial
Nom usuel TFB2M
Symbole de gène(s) Tfb2m
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Marqueur de protéine His-ABP-tag
Séquence GRFCILGSEAATRKHLPARNHCGLSDSSPQLWPEPDFRNPPRKASKASLDFKRYVTDRRLAETL
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Pureté ou qualité >80% by SDS-PAGE and Coomassie blue staining
Afficher plus Afficher moins
Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis