missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human TFDP3 Partial ORF (NP_057605, 1 a.a. - 100 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marque: Abnova™ H00051270-Q01.25ug
Les retours ne sont pas autorisés pour ce produit.
Afficher la politique du retour.
Description
TFDP3 is a member of the DP family of proteins, which form heterodimers with E2F proteins (see E2F1; MIM 189971) and regulate transcription (Qiao et al., 2007 [PubMed 17062573]).[supplied by OMIM]
Sequence: MPQRPAASNIPVVGSPNPPSTHFASQNQHSYSSPPWAGQHNRKGEKNGMGLCRLSMKVWETVQRKGTTSCQEVVGELVAKFRAASNHASPNESAYDVKNISpécification
NP_057605 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
36.74kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
MPQRPAASNIPVVGSPNPPSTHFASQNQHSYSSPPWAGQHNRKGEKNGMGLCRLSMKVWETVQRKGTTSCQEVVGELVAKFRAASNHASPNESAYDVKNI | |
RUO | |
TFDP3 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
Antibody Production, ELISA, Protein Array, Western Blot | |
51270 | |
TFDP3 (Human) Recombinant Protein (Q01) | |
25 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
CT30/E2F-like/HCA661/MGC161639 | |
TFDP3 | |
Recombinant | |
wheat germ expression system |