missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human THNSL2 (aa 268-356) Control Fragment Recombinant Protein

Code produit. 30205854
Click to view available options
Quantité:
100 μl
Conditionnement:
100µL
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Code produit. 30205854

Marque: Invitrogen™ RP96115

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57258 (PA5-57258. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

THNSL2 (threonine synthase-like 2), also known as TSH2, is a 484 amino acid protein belonging to the threonine synthase family. Utilizing pyridoxal phosphate as a cofactor, THNSL2 may function as a catabolic phospholyase on gamma and beta phosphorylated substrates. THNSL2 may also degrade O-phospho-threonine to alpha-ketobutyrate, ammonia and phosphate. Existing as four alternatively spliced isoforms, THNSL2 is encoded by a gene mapping to human chromosome 2p11.2. As the second largest human chromosome, chromosome 2 makes up approximately 8% of the human genome and contains 237 million bases encoding over 1,400 genes. A number of genetic diseases are linked to genes on chromosome 2. Harlequin icthyosis, a rare skin deformity, is associated with mutations in the ABCA12 gene. The lipid metabolic disorder sitosterolemia is associated with ABCG5 and ABCG8 gene defects. An extremely rare recessive genetic disorder, Alstrom syndrome, is related to mutations in the ALMS1 gene.
TRUSTED_SUSTAINABILITY

Spécification

Numéro d’adhésion Q86YJ6
Concentration ≥5.0 mg/mL
À utiliser avec (application) Blocking Assay, Control
Formule 1 M urea, PBS with no preservative; pH 7.4
Identification génétique (Entrez) 55258
Nom Human THNSL2 (aa 268-356) Control Fragment
Quantité 100 μl
État réglementaire RUO
Alias de gène BC051244; FLJ10916; FLJ35504; RGD1309144; secreted osteoclastogenic factor of activated T cells; Secreted osteoclastogenic factor of activated T-cells; SOFAT; THNSL2; threonine synthase like 2; threonine synthase-like 2; threonine synthase-like 2 (bacterial); threonine synthase-like 2 (S. cerevisiae); THS2; TSH2
Nom usuel THNSL2
Symbole de gène(s) THNSL2
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Marqueur de protéine His-ABP-tag
Séquence AGYIAQKIGLPIRLVVAVNRNDIIHRTVQQGDFSLSEAVKSTLASAMDIQVPYNMERVFWLLSGSDSQVTRALMEQFERTQSVNLPKEL
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Pureté ou qualité >80% by SDS-PAGE and Coomassie blue staining
Afficher plus Afficher moins
Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis