missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Protéines recombinantes
  4. 30201524

Invitrogen™ Human TIAM2 (aa 1562-1674) Control Fragment Recombinant Protein

Code produit. 30201524
Click to view available options
Quantité:
100 μl
Conditionnement:
100µL
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Code produit. 30201524

Marque: Invitrogen™ RP90642

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53098 (PA5-53098. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Modulates the activity of RHO-like proteins and connects extracellular signals to cytoskeletal activities. Acts as a GDP- dissociation stimulator protein that stimulates the GDP-GTP exchange activity of RHO-like GTPases and activates them. Mediates extracellular laminin signals to activate Rac1, contributing to neurite growth. Involved in lamellipodial formation and advancement of the growth cone of embryonic hippocampal neurons. Promotes migration of neurons in the cerebral cortex. When overexpressed, induces membrane ruffling accompanied by the accumulation of actin filaments along the altered plasma membrane. Activates specifically RAC1, but not CDC42 and RHOA.
TRUSTED_SUSTAINABILITY

Spécification

Numéro d’adhésion Q8IVF5
Concentration ≥5.0 mg/mL
À utiliser avec (application) Blocking Assay, Control
Formule 1 M urea, PBS with no preservative; pH 7.4
Identification génétique (Entrez) 26230
Nom Human TIAM2 (aa 1562-1674) Control Fragment
Quantité 100 μl
État réglementaire RUO
Alias de gène 3000002F19Rik; KIAA2016; mKIAA2016; RAS-related C3 botulinum substrate 1, guanine nucleotide exchange factor 1; SIF and TIAM1-like exchange factor; Stef; T cell lymphoma invasion and metastasis 2; T-cell lymphoma invasion and metastasis 2; T-cell lymphoma invasion and metastasis 2; RAS-related C3 botulinum substrate 1, guanine nucleotide exchange factor 1; TIAM2; TIAM-2; T-lymphoma invasion and metastasis-inducing protein 2
Nom usuel TIAM2
Symbole de gène(s) Tiam2
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Marqueur de protéine His-ABP-tag
Séquence IKESDILSDEDDDHRQTVKQGSPTKDIEIQFQRLRISEDPDVHPEAEQQPGPESGEGQKGGEQPKLVRGHFCPIKRKANSTKRDRGTLLKAQIRHQSLDSQSENATIDLNSVL
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Pureté ou qualité >80% by SDS-PAGE and Coomassie blue staining
Mehr anzeigen Weniger anzeigen
Berichtigung von Produktinhalten

Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.

Name des Produkts

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.

Vielen Dank, dass Sie uns helfen, unsere Website zu verbessern. Ihr Feedback wurde übermittelt