missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Protéines recombinantes
  4. 30205610

Invitrogen™ Human TIMP1 (aa 128-200) Control Fragment Recombinant Protein

Code produit. 30205610
Click to view available options
Quantité:
100 μl
Conditionnement:
100µL
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Code produit. 30205610

Marque: Invitrogen™ RP103156

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (73%), Rat (73%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TIMP1 (metalloproteinase inhibitor 1) is a metalloproteinase inhibitor that functions by forms one-to-one complexes with target metallproteinases, such as collagenases, and irreversible inactivates them by binding to their catalytic zinc cofactor. TIMP1 acts on MMP1, MMP2, MMP3, MMP7, MMP8, MMP9, MMP10, MMP11, MMP12, MMP14, and MMP16. It also functions as a growth factor that regulates cell differenation, migration, and cell death. TIMP1 activates cellular signaling cascades via CD63 and ITGB1.
TRUSTED_SUSTAINABILITY

Spécification

Numéro d’adhésion P01033
Concentration ≥5.0 mg/mL
À utiliser avec (application) Blocking Assay, Control
Formule 1 M urea, PBS with no preservative; pH 7.4
Identification génétique (Entrez) 7076
Nom Human TIMP1 (aa 128-200) Control Fragment
Quantité 100 μl
État réglementaire RUO
Alias de gène CLGI; collagenase inhibitor; Collagenase inhibitor 16C8 fibroblast; EG-1; Embryogenin-1; EPA; EPO; erythroid potentiating activity; erythroid-potentiating activity; Fibroblast collagenase inhibitor; FLJ90373; HCI; Metalloproteinase inhibitor; metalloproteinase inhibitor 1; metalloproteinase tissue inhibitor; metalloproteinase tissue inhibitor 1; MMP inhibitor; RP1-230G1.3; Timp; TIMP 1; TIMP metallopeptidase inhibitor 1; TIMP1; TIMP-1; TIMP-1 protein; tissue inhibitor of matrix metalloproteinase-1; tissue inhibitor of metal proteinases; tissue inhibitor of metallopeptidase 1; tissue inhibitor of metalloproteinase; tissue inhibitor of metalloproteinase 1; tissue inhibitor of metalloproteinase 1 (erythroid potentiating activity, collagenase inhibitor); tissue inhibitor of metalloproteinase-1; tissue inhibitor of metalloproteinases; tissue inhibitor of metalloproteinases 1; TPA-induced protein; TPA-S1
Nom usuel TIMP1
Symbole de gène(s) TIMP1
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Marqueur de protéine His-ABP-tag
Séquence WNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQ
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Pureté ou qualité >80% by SDS-PAGE and Coomassie blue staining
Afficher plus Afficher moins
Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis