missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Protéines recombinantes
  4. 30205405

Invitrogen™ Human UBR1 (aa 1194-1311) Control Fragment Recombinant Protein

Code produit. 30205405
Click to view available options
Quantité:
100 μl
Conditionnement:
100µL
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Code produit. 30205405

Marque: Invitrogen™ RP108823

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ELK1 is a component of the ternary complex that binds the serum response element (SRE) and mediates gene activity in response to serum and growth factors. ELK1 is phosphorylated by MAP kinase pathways at a cluster of S/T motifs at its C-terminus. Phosphorylation at these sites, particularly Ser383, is critical for transcriptional activation by ELK1. ELK1 appears to be a direct target of activated MAP kinase. Biochemical studies indicate that ELK1 is a good substrate for MAP kinase, the kinetics of ELK1 phosphorylation and activation correlate with MAP kinase activity, and interfering mutants of MAP kinase block ELK1 activation in vivo. ELK1 is a nuclear target for the ras-raf-MAPK signaling cascade. Alternatively spliced transcript variants encoding the same protein have been found for ELK1.
TRUSTED_SUSTAINABILITY

Spécification

Numéro d’adhésion Q8IWV7
Concentration ≥5.0 mg/mL
À utiliser avec (application) Blocking Assay, Control
Formule 1 M urea, PBS with no preservative; pH 7.4
Identification génétique (Entrez) 197131
Nom Human UBR1 (aa 1194-1311) Control Fragment
Quantité 100 μl
État réglementaire RUO
Alias de gène AI504731; E3 alpha; E3 ubiquitin-protein ligase UBR1; E3a ligase; JBS; LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase UBR1; MGC142065; MGC142067; N-recognin-1; RGD1562326; RING-type E3 ubiquitin transferase UBR1; ubiquitin ligase E3 alpha-I; ubiquitin protein ligase E3 component n-recognin 1; ubiquitin-protein ligase e3 componen n-recognin; ubiquitin-protein ligase E3-alpha; ubiquitin-protein ligase E3-alpha-1; Ubiquitin-protein ligase E3-alpha-I; Ubr1
Nom usuel UBR1
Symbole de gène(s) UBR1
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Marqueur de protéine His-ABP-tag
Séquence EYLCPLCKSLCNTVIPIIPLQPQKINSENADALAQLLTLARWIQTVLARISGYNIRHAKGENPIPIFFNQGMGDSTLEFHSILSFGVESSIKYSNSIKEMVILFATTIYRIGLKVPPD
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Pureté ou qualité >80% by SDS-PAGE and Coomassie blue staining
Afficher plus Afficher moins
Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis