missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Protéines recombinantes
  4. 30194332

Invitrogen™ Human UHRF1 (aa 207-276) Control Fragment Recombinant Protein

Code produit. 30194332
Click to view available options
Quantité:
100 μl
Conditionnement:
100µL
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Code produit. 30194332

Marque: Invitrogen™ RP108412

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (70%), Rat (70%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of a subfamily of RING-finger type E3 ubiquitin ligases. The protein binds to specific DNA sequences, and recruits a histone deacetylase to regulate gene expression. Its expression peaks at late G1 phase and continues during G2 and M phases of the cell cycle. It plays a major role in the G1/S transition by regulating topoisomerase IIalpha and retinoblastoma gene expression, and functions in the p53-dependent DNA damage checkpoint. Multiple transcript variants encoding different isoforms have been found for this gene.
TRUSTED_SUSTAINABILITY

Spécification

Numéro d’adhésion Q96T88
Concentration ≥5.0 mg/mL
À utiliser avec (application) Blocking Assay, Control
Formule 1 M urea, PBS with no preservative; pH 7.4
Identification génétique (Entrez) 29128
Nom Human UHRF1 (aa 207-276) Control Fragment
Quantité 100 μl
État réglementaire RUO
Alias de gène Ac2-121; AL022808; E3 ubiquitin-protein ligase UHRF1; fb97f09; FLJ21925; hNP95; Hnp95 Huhrf1; hUHRF1; HuNp95; ICBP90; inverted CCAAT box-binding protein of 90 kDa; Liver regeneration-related protein LRRG126; MGC138707; mUhrf1; Np95; nuclear phosphoprotein 95; nuclear protein; nuclear protein 95; Nuclear zinc finger protein Np95; RING finger protein 106; RING-type E3 ubiquitin transferase UHRF1; RNF106; TDRD22; transcription factor ICBP90; ub; ubiquitin like with PHD and ring finger domains 1; ubiquitin-like PHD and RING finger domain-containing protein 1; ubiquitin-like with PHD and ring finger domains 1; ubiquitin-like, containing PHD and RING finger domains, 1; ubiquitin-like-containing PHD and RING finger domains protein 1; Uhrf1; unm b1115; unm_b1115; wu:fb97f09; zgc:63539
Nom usuel UHRF1
Symbole de gène(s) UHRF1
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Marqueur de protéine His-ABP-tag
Séquence RARTIIKWQDLEVGQVVMLNYNPDNPKERGFWYDAEISRKRETRTARELYANVVLGDDSLNDCRIIFVDE
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Pureté ou qualité >80% by SDS-PAGE and Coomassie blue staining
Afficher plus Afficher moins
Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis