missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Protéines recombinantes
  4. 30195887

Invitrogen™ Human Versican (aa 35-168) Control Fragment Recombinant Protein

Code produit. 30195887
Click to view available options
Quantité:
100 μl
Conditionnement:
100µL
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Code produit. 30195887

Marque: Invitrogen™ RP102364

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Versican is a member of the family of large aggregating proteoglycans (also including aggrecan, brevican, and neurocan). The protein shows wide tissue distribution which includes fibrous, articular, and elastic cartilages, as well as nervous, epidermal, arterial, and loose connective tissues. Versican V1 has been shown to enhance cell proliferation, and also induce cell transformation and protect cells from apoptosis. This was demonstrated through its ability to downregulate the expression of proapoptotic Bad. Versican's existence as a extracellular matrix protein in human airways has also lead to the discovery of an inflammatory role in asthmatics.
TRUSTED_SUSTAINABILITY

Spécification

Numéro d’adhésion P13611
Concentration ≥5.0 mg/mL
À utiliser avec (application) Blocking Assay, Control
Formule 1 M urea, PBS with no preservative; pH 7.4
Identification génétique (Entrez) 1462
Nom Human Versican (aa 35-168) Control Fragment
Quantité 100 μl
État réglementaire RUO
Alias de gène 5430420N07Rik; 9430051N09; Chondroitin sulfate proteoglycan 2; chondroitin sulfate proteoglycan 2 (versican); chondroitin sulfate proteoglycan core protein 2; Cspg2; DPEAAE; ERVR; GHAP; glial hyaluronate-binding protein; hdf; heart defect; large fibroblast proteoglycan; NG2; PGM; PG-M; PG-M core protein; PG-M(V0); PG-M(V1); V1 Neo; VCAN; versican; versican core protein; Versican core protein precursor (Large fibroblast proteoglycan) (Chondroitin sulfate proteoglycan core protein 2) (PG-M); versican proteoglycan; Versican V0; WGN; WGN 1; WGN1
Nom usuel Versican
Symbole de gène(s) VCAN
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Marqueur de protéine His-ABP-tag
Séquence SLSGKVSLPCHFSTMPTLPPSYNTSEFLRIKWSKIEVDKNGKDLKETTVLVAQNGNIKIGQDYKGRVSVPTHPEAVGDASLTVVKLLASDAGLYRCDVMYGIEDTQDTVSLTVDGVVFHYRAATSRYTLNFEAA
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Pureté ou qualité >80% by SDS-PAGE and Coomassie blue staining
Afficher plus Afficher moins
Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis