missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Protéines recombinantes
  4. 30201700

Invitrogen™ Human VWA5A (aa 155-248) Control Fragment Recombinant Protein

Code produit. 30201700
Click to view available options
Quantité:
100 μl
Conditionnement:
100µL
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Code produit. 30201700

Marque: Invitrogen™ RP105192

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (74%), Rat (74%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

May play a role in tumorigenesis as a tumor suppressor. Altered expression of this protein and disruption of the molecular pathway it is involved in, may contribute directly to or modify tumorigenesis.
TRUSTED_SUSTAINABILITY

Spécification

Numéro d’adhésion O00534
Concentration 3.90 mg/mL
À utiliser avec (application) Neutralization, Control
Formule PBS, 1M urea with no preservative; pH 7.4
Identification génétique (Entrez) 4013
Nom Human VWA5A (aa 155-248) Control Fragment
Plage de pH 7.4
Méthode de purification Metal-chelate chromatography
Quantité 100 μl
Conditions de stockage -20°C, Avoid Freeze/Thaw Cycles
État réglementaire RUO
Alias de gène 5830475I06Rik; AW552491; BCSC1; BCSC-1; breast cancer suppressor candidate 1; E130119J22; Loh11cr2a; loss of heterozygosity 11 chromosomal region 2 gene A protein; Loss of heterozygosity 11 chromosomal region 2 gene A protein homolog; loss of heterozygosity, 11, chromosomal region 2, gene A; loss of heterozygosity, 11, chromosomal region 2, gene A homolog; Masa1; masa-1; Mast cell surface antigen 1; mast cell surface antigen-1; ortholog of mouse AW551984; von Willebrand factor A domain containing 5A; von Willebrand factor A domain-containing protein 5A; VWA5A
Nom usuel VWA5A
Symbole de gène(s) Vwa5a
Type de produit Protein
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Marqueur de protéine His-ABP-tag
Séquence FSGSSKDSCLNVKTPIVPVEDLPYTLSMVATIDSQHGIEKVQSNCPLSPTEYLGEDKTSAQVSLAAGHKFDRDVELLIYYNEVHTPSVVLEMGM
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Pureté ou qualité >80% by SDS-PAGE and Coomassie blue staining
Afficher plus Afficher moins
Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis