missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ IL12RB1 Recombinant Protein

Code produit. p-3719626
Click to view available options
Quantité:
10 μg
25 μg
Conditionnement:
10µg
25µg
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Code produit. 16106831

Marque: Abnova™ H00003594P01.10ug

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Human IL12RB1 full-length ORF recombinant protein with GST-tag at N-terminal

The protein encoded by this gene is a type I transmembrane protein that belongs to the hemopoietin receptor superfamily. This protein binds to interleukin 12 (IL12) with a low affinity, and is thought to be a part of IL12 receptor complex. This protein forms a disulfide-linked oligomer, which is required for its IL12 binding activity. The co expression of this and IL12RB2 proteins was shown to lead to the formation of high-affinity IL12 binding sites and reconstitution of IL12 dependent signaling. The lack of expression of this gene was found to result in the immunodeficiency of patients with severe mycobacterial and Salmonella infections. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported.

  • Theoretical MW (kDa): 67.65
  • Preparation method: In vitro wheat germ expression system
  • Purification: Glutathione Sepharose 4 fast flow
  • Storage buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer

Sequence: MEPLVTWVVPLLFLFLLPRQGAACRTSECCFQDPPYPDADSGSASGPRDLRCYRISSDRYECSWQYEGPTAGVSHFLRCCLSSGRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVESWARNQTEKSPEVTLQLYNSVKYEPPLGDIKVSKLAGQLRMEWETPDNQVGAEVQFRHRTPSSPWKLGDCGPQDDDTESCLCPLEMNVAQEFQLRRRRLGSQGSSWSKWSSPVCVPPENPPQPQVRFSVEQLGQDGRRRLTLKEQPTQLELPEGCQGLAPGTEVTYRLQLHMLSCPCKAKATRTLHLGKMPYLSGAAYNVAVISSNQFGPGLNQTWHIPADTHTDGMISAHCNLRLPDSRDSPASASRVAGITGICHHTRLILYF

Best use within three months from the date of receipt of this protein.

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Spécification

Numéro d’adhésion AAH29121
À utiliser avec (application) Antibody Production, Protein Array, ELISA, Western Blot
Formule 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Identification génétique (Entrez) 3594
Poids moléculaire 67.3
Nom IL12RB1 (Human) Recombinant Protein (P01)
Plage de pH 8
Méthode de préparation In vitro wheat germ expression system
Méthode de purification Glutathione Sepharose 4 Fast Flow
Test du contrôle qualité 12.5% SDS-PAGE Stained with Coomassie Blue.
Quantité 10 μg
Source Wheat Germ (in vitro)
Immunogène MEPLVTWVVPLLFLFLLPRQGAACRTSECCFQDPPYPDADSGSASGPRDLRCYRISSDRYECSWQYEGPTAGVSHFLRCCLSSGRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVESWARNQTEKSPEVTLQLYNSVKYEPPLGDIKVSKLAGQLRMEWETPDNQVGAEVQFRHRTPSSPWKLGDCGPQDDDTESCLCPLEMNVAQEFQLRRRRLGSQGSSWSKWSSPVCVPPENPPQPQVRFSVEQLGQDGRRRLTLKEQPTQLELPEGCQGLAPGTEVTYRLQLHMLSCPCKAKATRTLHLGKMPYLSGAAYNVAVISSNQFGPGLNQTWHIPADTHTDGMISAHCNLRLPDSRDSPASASRVAGITGICHHTRLILYF
Conditions de stockage Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Alias de gène CD212/IL-12R-BETA1/IL12RB/MGC34454
Nom usuel IL12RB1
Symbole de gène(s) IL12RB1
Réactivité croisée Human
Espèces Wheat Germ (in vitro)
Recombinant Recombinant
Marqueur de protéine GST
Forme Solution
Afficher plus Afficher moins
Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis