missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Pescadillo. Source: E.coli Amino Acid Sequence: LYQLLNLHYPPKLEGQAQAEAKAGEGTYALDSESCMEKLAALSASLARVVVPATEEEAEVDEFPTDGEMSAQEEDRRKE The Pescadillo Recombinant Protein Antigen is derived from E. coli. The Pescadillo Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Spécification
Spécification
| Gene ID (Entrez) | 23481 |
| Méthode de purification | >80% by SDS-PAGE and Coomassie blue staining |
| Nom usuel | Pescadillo Recombinant Protein Antigen |
| Contenu et stockage | Store at −20°C. Avoid freeze-thaw cycles. |
| Formule | PBS and 1M Urea, pH 7.4. |
| À utiliser avec (application) | Blocking/Neutralizing, Control |
| Alias de gène | pescadillo homolog, pescadillo homolog 1, containing BRCT domain (zebrafish), PESpescadillo (zebrafish) homolog 1, containing BRCT domain |
| Symbole de gène(s) | PES1 |
| Type d’étiquette | Unlabeled |
| Type de produit | Recombinant Protein Antigen |
| Afficher plus |
Usage exclusivement réservé à la recherche.
Nom du produit
En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.
Vous avez repéré une opportunité d'amélioration ?