missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Protéines recombinantes
  4. Abnova™ PTGES3 Recombinant Protein

Abnova™ PTGES3 Recombinant Protein

Artikelnummer. p-3721112
missing translation for 'orderingAttributeHoverText'
Quantité:
10 μg
25 μg
missing translation for 'unitSize'
10µg
25µg
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Artikelnummer. 16105622

missing translation for 'mfr': Abnova™ H00010728P01.10ug

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Spezifikation

Numéro d’adhésion AAH03005
À utiliser avec (application) Antibody Production, Protein Array, ELISA, Western Blot
Formule 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Identification génétique (Entrez) 10728
Poids moléculaire 43.34
Nom TEBP (Human) Recombinant Protein (P01)
Plage de pH 8
Méthode de préparation In vitro wheat germ expression system
Méthode de purification Glutathione Sepharose 4 Fast Flow
Test du contrôle qualité 12.5% SDS-PAGE Stained with Coomassie Blue.
Quantité 10 μg
Source Wheat Germ (in vitro)
Immunogène MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKMPDLE
Conditions de stockage Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Alias de gène P23/TEBP/cPGES
Nom usuel PTGES3
Symbole de gène(s) PTGES3
Réactivité croisée Human
Espèces Wheat Germ (in vitro)
Recombinant Recombinant
Marqueur de protéine GST
Forme Solution
Mehr anzeigen Weniger anzeigen
Berichtigung von Produktinhalten

Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.

Name des Produkts

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.

Vielen Dank, dass Sie uns helfen, unsere Website zu verbessern. Ihr Feedback wurde übermittelt