missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Human HGF B Protein

A cDNA sequence encoding the HGF B was constructed and used to recombinantly synthesize the protein.

Marque:  enQuireBio™ QP12230-2ug

Code nomenclature Nacres: NA.28

Informations supplémentaires : Poids : 0.01000kg

 Afficher plus de versions de ce produit

Code produit. 15979768

  • 131.00€ / 2µg
Expédition estimée: 02-09-2024
pour voir le stock disponible 

Description

Description

Spécification

Spécification

HGF B Protein
Research Use Only
Recombinant Protein
E. coli
VVNGIPTRTNIGWMVSLRYRNKHICGGSLIKESWVLTARQCFPSRDLKDYEAWLGIHDVHGRGDEKCKQVLNVSQLVYGPEGSDLVLMKLARPAVLDDFVSTIDLPNYGCTIPEKTSCSVYGWGYTGLINYDGLLRVAHLYIMGNEKCSQHHRGKVTLNESEICAGAEKIGSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKIILTYKVPQS
Greater than 95.0% as determined by SDS-PAGE.
2 μg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Human
His
HGF-B protein is supplied in 25mM Na. Acetate, pH 4.8, 1mM EDTA and 50% glycerol.
Suggestions de produits

Suggestions de produits

Vidéos
FDS
Documents

Documents

Certificats
Promotions

Promotions