missing translation for 'onlineSavingsMsg'
Learn More
Learn More
enQuireBio™ Recombinant Human HGF B Protein
A cDNA sequence encoding the HGF B was constructed and used to recombinantly synthesize the protein.
Marque: enQuireBio™ QP12230-2ug
Informations supplémentaires : Poids : 0.01000kg
Spécification
| HGF B Protein | |
| 2 μg | |
| Not Determined. Testing recommended prior to use in cell culture and can be performed upon request. | |
| Human | |
| His | |
| HGF-B protein is supplied in 25mM Na. Acetate, pH 4.8, 1mM EDTA and 50% glycerol. |
| Greater than 95.0% as determined by SDS-PAGE. | |
| Research Use Only | |
| Recombinant Protein | |
| E. coli | |
| VVNGIPTRTNIGWMVSLRYRNKHICGGSLIKESWVLTARQCFPSRDLKDYEAWLGIHDVHGRGDEKCKQVLNVSQLVYGPEGSDLVLMKLARPAVLDDFVSTIDLPNYGCTIPEKTSCSVYGWGYTGLINYDGLLRVAHLYIMGNEKCSQHHRGKVTLNESEICAGAEKIGSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKIILTYKVPQS |