missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Human RAC1 Protein

A cDNA sequence encoding the RAC1 was constructed and used to recombinantly synthesize the protein.

Marque:  enQuireBio™ QP13249-50ug

Informations supplémentaires : Poids : 0.01000kg

 Afficher plus de versions de ce produit

Code produit. 15982969

  • 203.00€ / 50µg
Expédition estimée: 04-04-2024
pour voir le stock disponible 

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!


Description

Description

Spécification

Spécification

RAC1 Protein
Research Use Only
Recombinant Protein
E. coli
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCP PPVKKRKRKCLLL
Greater than 95.0% as determined by SDS-PAGE.
50 μg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Human
Untagged
The protein solution contains 20mM Tris-HCl pH 7.5, 2mM EDTA and 1mM DTT.
Recommandations

Recommandations

Vidéos
FDS
Documents

Documents

Certificats
Promotions

Promotions