missing translation for 'onlineSavingsMsg'
Learn More
Learn More
enQuireBio™ Recombinant Human RAC1 Protein
A cDNA sequence encoding the RAC1 was constructed and used to recombinantly synthesize the protein.
Marque: enQuireBio™ QP13249-50ug
Code nomenclature Nacres: NA.28
Informations supplémentaires : Poids : 0.01000kg
Spécification
RAC1 Protein | |
Research Use Only | |
Recombinant Protein | |
E. coli | |
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCP PPVKKRKRKCLLL | |
Greater than 95.0% as determined by SDS-PAGE. |
50 μg | |
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request. | |
Human | |
Untagged | |
The protein solution contains 20mM Tris-HCl pH 7.5, 2mM EDTA and 1mM DTT. |