missing translation for 'onlineSavingsMsg'
Learn More
Learn More
enQuireBio™ Recombinant Human RAC1 Protein
A cDNA sequence encoding the RAC1 was constructed and used to recombinantly synthesize the protein.
Marque: enQuireBio™ QP13249-50ug
Informations supplémentaires : Poids : 0.01000kg
Spécification
| RAC1 Protein | |
| 50 μg | |
| Not Determined. Testing recommended prior to use in cell culture and can be performed upon request. | |
| Human | |
| Untagged | |
| The protein solution contains 20mM Tris-HCl pH 7.5, 2mM EDTA and 1mM DTT. |
| Greater than 95.0% as determined by SDS-PAGE. | |
| Research Use Only | |
| Recombinant Protein | |
| E. coli | |
| MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCP PPVKKRKRKCLLL |