missing translation for 'onlineSavingsMsg'
Learn More
Learn More
enQuireBio™ Recombinant Human RB1 Protein
A cDNA sequence encoding the RB1 was constructed and used to recombinantly synthesize the protein.
Marque: enQuireBio™ QP13275-1mg
Informations supplémentaires : Poids : 0.01000kg
Spécification
| RB1 Protein | |
| 1 mg | |
| Not Determined. Testing recommended prior to use in cell culture and can be performed upon request. | |
| Human | |
| His | |
| The RB1 (1 mg/ml) was lyophilized after extensive dialyses against 1xPBS pH 7.4. |
| Greater than 95.0% as determined by:(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE. | |
| Research Use Only | |
| Recombinant Protein | |
| E. coli | |
| MASFPSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSRILVSIGESFGTSEKFQKINQMVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGSDEADGSKHLPGESKFQQKLAEMTSTRTRMQKQKMNDSMDTSNKEEKHHHHHH |