missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Human SELE Protein

Code produit. p-7151341
Click to view available options
Quantité:
1 mg
10 μg
2 μg
Conditionnement:
10µg
1mg
2µg
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Code produit. 15993599

Marque: enQuireBio™ QP134502ug

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

A cDNA sequence encoding the SELE was constructed and used to recombinantly synthesize the protein.

Spécification

Nom SELE Protein
Quantité 2 μg
État réglementaire Research Use Only
Concentration en endotoxines Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Type de produit Recombinant Protein
Réactivité croisée Human
Espèces Human (HEK293)
Marqueur de protéine His
Séquence WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIPVCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNEKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQWTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHWSGLLPTCEAPTESNIPVDHHHHHH
Tampon SELE was lyophilized from a 0.2 microm filtered solution of PBS and 4% Mannitol, pH 7.5.
Pureté ou qualité Greater than 95% as determined by SDS-PAGE.
Afficher plus Afficher moins
Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis