Abnova™ SH2D1A (Human) Recombinant Protein

Name: Abnova&trade; SH2D1A (Human) Recombinant Protein
Brand: Abnova&trade;
SKU: 16107501
Price: 335.00 EUR

Human SH2D1A full-length ORF ( AAH20732, 1 a.a. - 128 a.a.) recombinant protein with GST-tag at N-terminal.

Marque: Abnova™ H00004068-P01.10ug

Informations supplémentaires : Poids : 0.00010kg

Code produit. 16107501

Expédition estimée: 09-05-2023
pour voir le stock disponible

Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Description

Sequence: MDAVAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTETGSWSAETAPGVHKRYFRKIKNLISAFQKPDQGIVIPLQYPVEKKSSARSTQGTTGIREDPDVCLKAP

Spécification

Numéro d’adhésion	AAH20732
Nom	SH2 domain protein 1A
Test du contrôle qualité	125% SDS-PAGE Stained with Coomassie Blue
Conditions de stockage	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Symbole de gène(s)	SH2D1A
Marqueur de protéine	GST

Identification génétique (Entrez)	4068
Méthode de préparation	Wheat germ expression system
Quantité	10 μg
Alias de gène	DSHP, EBVS, FLJ18687, FLJ92177, IMD5, LYP, MTCP1, SAP, XLP, XLPD
Espèces hôtes	Wheat Germ (in vitro)
Tampon	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer

Description