missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ SH2D1A (Human) Recombinant Protein
Human SH2D1A full-length ORF ( AAH20732, 1 a.a. - 128 a.a.) recombinant protein with GST-tag at N-terminal.
Marque: Abnova™ H00004068-P01.10ug
Informations supplémentaires : Poids : 0.00010kg
Description
- Sequence: MDAVAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTETGSWSAETAPGVHKRYFRKIKNLISAFQKPDQGIVIPLQYPVEKKSSARSTQGTTGIREDPDVCLKAP
Spécification
| AAH20732 | |
| SH2 domain protein 1A | |
| 125% SDS-PAGE Stained with Coomassie Blue | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| SH2D1A | |
| GST |
| 4068 | |
| Wheat germ expression system | |
| 10 μg | |
| DSHP, EBVS, FLJ18687, FLJ92177, IMD5, LYP, MTCP1, SAP, XLP, XLPD | |
| Wheat Germ (in vitro) | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |