missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Protéines recombinantes
  4. Abnova™ SIVA Recombinant Protein

Abnova™ SIVA Recombinant Protein

Code produit. p-3721995
Click to view available options
Quantité:
10 μg
25 μg
Conditionnement:
10µg
25µg
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Code produit. 16105352

Marque: Abnova™ H00010572P01.10ug

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Spécification

Numéro d’adhésion AAH34562
À utiliser avec (application) Antibody Production, Protein Array, ELISA, Western Blot
Formule 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Identification génétique (Entrez) 10572
Poids moléculaire 37.84
Nom SIVA (Human) Recombinant Protein (P01)
Plage de pH 8
Méthode de préparation In vitro wheat germ expression system
Méthode de purification Glutathione Sepharose 4 Fast Flow
Test du contrôle qualité 12.5% SDS-PAGE Stained with Coomassie Blue.
Quantité 10 μg
Source Wheat Germ (in vitro)
Immunogène MPKRSCPFADVAPLQLKVRVSQRELSRGVCAERYSQEVFDPSGVASIACSSCVRPVDGKAVCGQCERALCGQCVRTCWGCGSVACTLCGLVDCSDMYEKVLCTSCAMFET
Conditions de stockage Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Alias de gène CD27BP/SIVA/Siva-1/Siva-2
Nom usuel SIVA1
Symbole de gène(s) SIVA1
Réactivité croisée Human
Espèces Wheat Germ (in vitro)
Recombinant Recombinant
Marqueur de protéine GST
Forme Solution
Afficher plus Afficher moins
Berichtigung von Produktinhalten

Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.

Name des Produkts

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.

Vielen Dank, dass Sie uns helfen, unsere Website zu verbessern. Ihr Feedback wurde übermittelt