missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Réactifs biochimiques
  4. Peptides
  5. 18366490

R&D Systems™ UbcH6/UBE2E1 Recombinant Protein Antigen

Artikelnummer. 18366490 Alle ansehen Bio Techne Produkte
Ansicht ändern
Click to view available options
Quantité:
0,1 ml
Packungsgröße:
0.10mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Quantité Packungsgröße
18366490 0,1 ml 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 18366490 Lieferant R&D Systems™ Lieferanten-Nr. NBP186886PEP
 Article restreint
Expédition estimée: 22-01-2027
Zum Warenkorb hinzufügen
Zum Warenkorb hinzufügen

missing translation for 'validMainframeMsg'

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

A Novus product, part of R&D Systems. Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human UBE2E1. The UbcH6/UBE2E1 Recombinant Protein Antigen is derived from E. coli. The UbcH6/UBE2E1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

This is a blocking peptide for NBP1-86886. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.

TRUSTED_SUSTAINABILITY

Spezifikation

Gene ID (Entrez) 7324
Espèces Human
Gamme de produits Novus
Méthode de purification Chromatography
Pureté >80%
Concentration 0.5mg/mL
Contenu et stockage Store at -20°C. Avoid freeze-thaw cycles.
Formule PBS and 1M Urea, pH 7.4.
À utiliser avec (application) Blocking/Neutralizing, Control
Symbole de gène(s) UBE2E1
Type d’étiquette Unlabeled
Poids moléculaire 29kDa
Type de produit UbcH6/UBE2E1
Quantité 0,1 ml
État réglementaire RUO
Source E.Coli
Réactivité spécifique This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86886. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Immunogène LLSTSAKRIQKELADITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFTPEYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTIS
Mehr anzeigen Weniger anzeigen

Usage exclusivement réservé à la recherche

Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Politique de confidentialité.