Résultats de la recherche filtrée
Les produits de certains de nos fournisseurs ne s'affichent pas dans les résultats de la recherche filtrée. Veuillez
supprimer tous les filtres
pour voir ces produits.
1
–
15
de
50,340
résultats
| Poids moléculaire | 33.4 kDa |
|---|---|
| Protéine | Protein A |
| Conditions de stockage | Store at -20°C to -70°C as supplied. After reconstitution, store at 2°C to 8°C for 1 month and at -20°C to -70°C for long term storage. Avoid repeated freeze-thaw cycles. |
| Catégorie de recherche | Epitope Tags |
| Concentration en endotoxines | Less than 0.1 EU/ug of Protein A as determined by LAL method. |
| Pureté ou qualité | >97% pure by SDS-PAGE and HPLC |
| Reconstitution | Dissolve in distilled water or saline. |
| Identification génétique (Entrez) | 3919448 |
| Concentration | LYOPH |
| Formule | Lyophilized from additive free solution. |
| Alias de gène | Immunoglobulin G binding protein A, SPA, Staphylococcal protein A |
| À utiliser avec (application) | PAGE,Bioactivity,HPLC |
| Protéine | alpha-Synuclein |
|---|---|
| Conditions de stockage | Store at -80C. Avoid freeze-thaw cycles. |
| Catégorie de recherche | Alzheimers Research, Apoptosis, Cell Biology, Cellular Markers, Neurodegeneration, Neuroscience |
| Pureté ou qualité | >95%, by SDS-PAGE |
| Identification génétique (Entrez) | 6622 |
| Symbole de gène(s) | SNCA |
| Formule | PBS pH 7.4 |
| Alias de gène | alpha-synuclein, I+/--synuclein, MGC110988, NACP, non A-beta component of AD amyloid, Non-A beta component of AD amyloid, Non-A4 component of amyloid precursor, PARK1, PARK4, PD1, SNCA, synuclein alpha-140, synuclein, alpha (non A4 component of amyloid precursor), truncated alpha synuclein |
| À utiliser avec (application) | Electron Microscopy,In vitro Assay,In vivo Assay,SDS-PAGE,Western Blot |
| Poids moléculaire | MolecularWeight-theroretical: 95.26 kDa |
|---|---|
| Protéine | XRCC1 |
| Conditions de stockage | Store at -80°C. Avoid freeze-thaw cycles. |
| Catégorie de recherche | Apoptosis, Base Excision Repair, Cancer, DNA Repair, Homologous Recombination, Tumor Suppressors |
| Pureté ou qualité | >80% by SDS-PAGE and Coomassie blue staining |
| Identification génétique (Entrez) | 7515 |
| Symbole de gène(s) | XRCC1 |
| Formule | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Alias de gène | DNA repair protein XRCC1, RCC, X-ray repair complementing defective repair in Chinese hamster cells 1, X-ray repair cross-complementing protein 1, X-ray-repair, complementing defective, repair in Chinese hamster |
| À utiliser avec (application) | Western Blot,ELISA,Protein Array,Immunoaffinity Purification |
| Poids moléculaire | MolecularWeight-theroretical: 26.7 kDa |
|---|---|
| Protéine | UBE2R1/CDC34 |
| Conditions de stockage | Store at -20°C. Avoid freeze/thaw cycles. |
| Catégorie de recherche | Cancer, Cell Cycle and Replication, Core ESC Like Genes, Stem Cell Markers |
| Concentration en endotoxines | Less than 0.1 EU/μg of UBE2R1/CDC34 as determined by LAL method. |
| Pureté ou qualité | >95%, by SDS-PAGE and HPLC |
| Identification génétique (Entrez) | 997 |
| Symbole de gène(s) | CDC34 |
| Formule | A 0.2 μm filtered concentrated solution in 50 mM HEPES, pH 7.0, 125 mM NaCl, 10 % Glycerol, 1 mM DTT. |
| Alias de gène | cell division cycle 34, cell division cycle 34 homolog (S. cerevisiae), E2-CDC34, EC 6.3.2.19, UBC3, UBE2R1UBCH3, ubiquitin carrier protein, ubiquitin-conjugating enzyme E2 R1, Ubiquitin-conjugating enzyme E2-32 kDa complementing, Ubiquitin-conjugating enzyme E2-CDC34, Ubiquitin-protein ligase R1 |
| À utiliser avec (application) | SDS-PAGE |
| Poids moléculaire | MolecularWeight-theroretical: 18.4 kDa |
|---|---|
| Protéine | LIGHT/TNFSF14 |
| Conditions de stockage | Store at -20°C to -70°C as supplied. After reconstitution, store at 2 to 8 C for 1 month and (at -20°C to -70°C for long term storage. Avoid repeated freeze/thaw cycles.) |
| Catégorie de recherche | Apoptosis |
| Concentration en endotoxines | Less than 1 EU/μg of LIGHT/TNFSF14 as determined by LAL method. |
| Pureté ou qualité | >95%, by SDS-PAGE and HPLC |
| Reconstitution | Recommended to centrifuge prior to opening. Reconstitute in 100 mM HAC to a concentration of 0.1-1.0 mg/mL Apportion stock solutions into working aliquots and store (at <-20°C.) |
| Identification génétique (Entrez) | 8740 |
| Symbole de gène(s) | TNFSF14 |
| Formule | Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH7.4. |
| Alias de gène | CD258, CD258 antigen, delta transmembrane LIGHT, Herpes virus entry mediator ligand, Herpesvirus entry mediator ligand, HVEM-L, HVEMLherpesvirus entry mediator-ligand, ligand for herpesvirus entry mediator, LIGHTherpesvirus entry mediator A, LTg, TR2, tumor necrosis factor (ligand) superfamily, member 14, tumor necrosis factor ligand superfamily member 14, tumor necrosis factor receptor-like 2, tumor necrosis factor superfamily member LIGHT |
| À utiliser avec (application) | Western Blot,Bioactivity |
| Protéine | IFN-gamma |
|---|---|
| Numéro d’adhésion | P01579 |
| Catégorie de recherche | Biologically Active Proteins, Cytokine Research, Immunology, Innate Immunity, Stem Cell Markers |
| Concentration en endotoxines | Less than 1 EU/ug of IFN-gamma as determined by LAL method. |
| Pureté ou qualité | >98% pure by SDS-PAGE and HPLC |
| Concentration | LYOPH |
| À utiliser avec (application) | PAGE,Bioactivity |
| Poids moléculaire | 16.9 kDa |
| Conditions de stockage | Store at -20°C to -70°C as supplied. After reconstitution, store at 2°C to 8°C for 1 month and at -20°C to -70°C for long term storage. Avoid repeated freeze-thaw cycles. |
| Reconstitution | Recommended to centrifuge prior to opening. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0mg/mL. Apportion stock solutions into working aliquots and store at <-20°C. |
| Identification génétique (Entrez) | 3458 |
| Symbole de gène(s) | IFNG |
| Formule | Lyophilized from a 0.2 um filtered concentrated solution in PBS, pH 7.4. |
| Alias de gène | IFG, IFI, IFN-gamma, Immune interferon, interferon gamma, interferon, gamma |
| Poids moléculaire | 33.5 kDa |
|---|---|
| Protéine | Protein A |
| Conditions de stockage | Store at -20°C to -70°C as supplied. After reconstitution, store at 2°C to 8°C for 1 month and at -20°C to -70°C for long term storage. Avoid repeated freeze-thaw cycles. |
| Catégorie de recherche | Biologically Active Proteins, Epitope Tags |
| Concentration en endotoxines | Less than 0.1 EU/ug of Protein A as determined by LAL method. |
| Pureté ou qualité | >98% pure by SDS-PAGE and HPLC |
| Reconstitution | Reconstitute with distilled water or saline. |
| Identification génétique (Entrez) | 3919448 |
| Concentration | LYOPH |
| Formule | Lyophilized from additive free solution. |
| Alias de gène | Immunoglobulin G binding protein A, SPA, Staphylococcal protein A |
| À utiliser avec (application) | PAGE,Bioactivity |
| Poids moléculaire | M.W. Theoretical: 50 kDa |
|---|---|
| Protéine | Listeria monocytogenes p60 |
| Numéro d’adhésion | P21171 |
| Conditions de stockage | Store at 4C short term. Aliquot and Store at -20°C long term. Avoid freeze-thaw cycles. |
| Catégorie de recherche | Immunology |
| Concentration en endotoxines | <1 EU/μg purified protein (LAL test; Lonza). |
| Pureté ou qualité | >90% SDS-PAGE |
| Concentration | 0.5 mg/ml |
| Formule | Liquid. 0.2um-filtered solution in PBS, pH 7.2 |
| Alias de gène | IAP p60 from Listeria Monocytogenes, Invasion-associated Protein p60, Invasion-associated Protein p60 from Listeria Monocytogenes, invasion-associated-protein, p60 protein |
| À utiliser avec (application) | SDS-PAGE |
| État réglementaire | RUO |
|---|---|
| Poids moléculaire | 38.8kDa |
| Conditions de stockage | Store at -80°C. Avoid freeze-thaw cycles. |
| Pureté ou qualité | >95% |
| Conjugué | Unconjugated |
| Méthode de purification | SDS-PAGE |
| Concentration | 1mg/mL |
| Formule | Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 10% glycerol, 2mM DTT, 0.1M NaCl. |
| Nom usuel | WDR5 |
| À utiliser avec (application) | SDS-PAGE |
Novus Biologicals™ gamma Tubulin Protein
Highly purified. Generating reliable and reproducible results. Applications: SDS-Page
Novus Biologicals™ PMM2/Phosphomannomutase 2 Protein
Highly purified. Generating reliable and reproducible results.
| État réglementaire | RUO |
|---|---|
| Poids moléculaire | 30.2kDa |
| Conditions de stockage | Store at -80°C. Avoid freeze-thaw cycles. |
| Immunogène | PMM2, 1-246 aa. Sequence: MGSSHHHHHHSSGLVPRGSHMAAPGPALCLFDVDGTLTAPRQKITKEMDDFLQKLRQKIKIGVVGGSDFEKVQEQLGNDVVEKYDYVFPENGLVAYKDGKLLCRQNIQSHLGEALIQDLINYCLSYIAKIKLPKKRGTFIEFRNGMLNVSPIGRSCSQEERIEFYELDKKENIRQKFVADLRKEFAGKGLTFSIGGQISFDVFPDGWDKRYCLRHVENDGYKTIYFFGDKTMPGGNDHEIFTDPRTMGYSVTAPEDTRRICELLFS |
| Pureté ou qualité | >95% |
| Conjugué | Unconjugated |
| Identification génétique (Entrez) | 5373 |
| Méthode de purification | Protein |
| Concentration | 1mg/mL |
| Formule | Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 10% glycerol 1mM DTT, 0.1M NaCl. |
| Source | Human |
| Nom usuel | PMM2/Phosphomannomutase 2 |
| À utiliser avec (application) | ELISA,SDS-PAGE |
| État réglementaire | RUO |
|---|---|
| Poids moléculaire | 44.4kDa |
| Conditions de stockage | Store at -80°C. Avoid freeze-thaw cycles. |
| Immunogène | MGSSHHHHHH SSGLVPRGSH MAALRQPQVA ELLAEARRAF REEFGAEPEL AVSAPGRVNL IGEHTDYNQG LVLPMALELM TVLVGSPRKD GLVSLLTTSE GADEPQRLQF PLPTAQRSLE PGTPRWANYV KGVIQYYPAA PLPGFSAVVV SSVPLGGGLS SSASLEVATY TFLQQLCPDS GTIAARAQVC QQAEHSFAGM PCGIMDQFIS LMGQKGHALL IDCRSLETSL VPLSDPKLAV LITNSNVRHS LASSEYPVRR RQCEEVARAL GKESLREVQL EELEAARDLV SKEGFRRARH VVGEIRRTAQ AAAALRRGDY RAFGRLMVES HRSLRDDYEV SCPELDQLVE AALAVPGVYG SRMTGGGFGG CTVTLLEASA APHAMRHIQE HYGGTATFYL SQAADGAKVL CL |
| Pureté ou qualité | >95% |
| Conjugué | Unconjugated |
| Identification génétique (Entrez) | 2584 |
| Méthode de purification | Protein |
| Concentration | 0.5mg/mL |
| Formule | 20mM Tris-HCl buffer (pH 8.0) containing 20% glycerol, 0.1M NaCl, 1mM DTT |
| Source | Human |
| Nom usuel | GALK1 |
| À utiliser avec (application) | ELISA,SDS-PAGE |