missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ ACTB Recombinant Protein

Full-length ORF with GST-tag at N-terminal

Marque:  Abnova™ H00000060-P01.25ug

Informations supplémentaires : Poids : 0.00010kg

 Afficher plus de versions de ce produit

Code produit. 16151211

  • 545.00€ / 25µg
Expédition estimée: 21-06-2022
pour voir le stock disponible 

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!


Description

Description

  • ACTB gene encodes one of six different actin proteins
  • Purification: glutathione sepharose 4 fast flow
  • Molecular weight: 66.99kDa
  • Preparation method:in vitro wheat germ expression system
  • Storage Buffer:50 mM Tris-HCI, 10 mM reduced glutathione
  • pH=8.0 in elution buffer

Sequence: MDDDIAALVVDNGSGMCKAGFAGDDAPRAVSPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGMKILTE
RGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERRYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF

Best when used within three months from the date of receipt.

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Spécification

Spécification

AAH01301
Solution
60
ACTB (Human) Recombinant Protein (P01)
In vitro wheat germ expression system
12.5% SDS-PAGE Stained with Coomassie Blue.
Wheat Germ (in vitro)
PS1TP5BP1
ACTB
Wheat Germ (in vitro)
GST
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
66.99
8
Glutathione Sepharose 4 Fast Flow
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
ACTB
Human
Yes
Vidéos
FDS
Documents
Certificats
Promotions

Promotions