missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ ACTB Recombinant Protein
Full-length ORF with GST-tag at N-terminal
Marque: Abnova™ H00000060-P01.25ug
Informations supplémentaires : Poids : 0.00010kg
Description
- ACTB gene encodes one of six different actin proteins
- Purification: glutathione sepharose 4 fast flow
- Molecular weight: 66.99kDa
- Preparation method:in vitro wheat germ expression system
- Storage Buffer:50 mM Tris-HCI, 10 mM reduced glutathione
- pH=8.0 in elution buffer
Sequence: MDDDIAALVVDNGSGMCKAGFAGDDAPRAVSPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGMKILTE
RGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERRYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF
Best when used within three months from the date of receipt.
ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Spécification
| AAH01301 | |
| 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
| 66.99 | |
| 8 | |
| Glutathione Sepharose 4 Fast Flow | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| ACTB | |
| Human | |
| Recombinant | |
| Solution |
| Antibody Production, Protein Array, ELISA, Western Blot | |
| 60 | |
| ACTB (Human) Recombinant Protein (P01) | |
| In vitro wheat germ expression system | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| Wheat Germ (in vitro) | |
| PS1TP5BP1 | |
| ACTB | |
| Wheat Germ (in vitro) | |
| GST |