missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ ACYP1 (Human) Recombinant Protein

Human ACYP1 full-length ORF ( AAH35568, 1 a.a. - 99 a.a.) recombinant protein with GST-tag at N-terminal.

Marque:  Abnova™ H00000097-P01.10ug

Informations supplémentaires : Poids : 0.00010kg

 Afficher plus de versions de ce produit

Code produit. 16151251

  • 359.00€ / 10µg
Expédition estimée: 24-06-2022
pour voir le stock disponible 

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!


Description

Description

  • Sequence: MAEGNTLISVDYEIFGKVQGVFFRKHTQAEGKKLGLVGWVQNTDRGTVQGQLQGPISKVRHMQEWLETRGSPKSHIDKANFNNEKVILKLDYSDFQIVK
Spécification

Spécification

AAH35568
acylphosphatase 1, erythrocyte (common) type
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
ACYP1
GST
97
Wheat germ expression system
10 μg
ACYPE
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Vidéos
FDS
Documents
Certificats
Promotions

Promotions