missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ AMBP (Human) Recombinant Protein

Human AMBP full-length ORF ( AAH41593, 19 a.a. - 352 a.a.) recombinant protein with GST-tag at N-terminal.

Marque:  Abnova™ H00000259-P01.25ug

Informations supplémentaires : Poids : 0.00010kg

 Afficher plus de versions de ce produit

Code produit. 16151531

  • 545.00€ / 25µg
Expédition estimée: 21-06-2022
pour voir le stock disponible 

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!


Description

Description

  • Sequence: AGPVPTPPDNIQVQGNFNISRIYGKWYNLAIGSTCPWLKKIMDRMTVSTLVLGEGATEAEISMTSTRWRKGVCEETSGAYEKTDTDGKFLYHKSKWNITMESYVVHTNYDEYAIFLTKKFSRHHGPTITAKLYGRAPQLRETLLQDFRVVAQGVGIPEDSIFTMADRGECVPGEQEPEPILIPRVRRAVLPQEEEGSGGGQLVTEVTKKEDSCQLGYSAGPCMGMTSRYFYNGTSMACETFQYGGCMGNGNNFVTEKECLQTCRTVAACNLPIVRGPCRAFIQLWAFDAVKGKCVLFPYGGCQGNGNKFYSEKECREYCGVPGDGDEELLRFSN
Spécification

Spécification

AAH41593
alpha-1-microglobulin/bikunin precursor
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
AMBP
GST
259
Wheat germ expression system
25 μg
EDC1, HCP, HI30, IATIL, ITI, ITIL, ITILC, UTI
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Vidéos
FDS
Documents
Certificats
Promotions

Promotions