missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticorps
  4. Anticorps primaires
  5. Tous les anticorps primaires
  6. 16174066

coatomer protein complex, subunit epsilon, Mouse, Polyclonal Antibody, Abnova™

Code produit 16174066
Modifier l'affichage
Click to view available options
Quantité:
50 μL
Conditionnement:
50µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité unitSize
16174066 50 μL 50µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 16174066 Fournisseur Abnova Code fournisseur H00011316A01.50uL

Please to purchase this item. Need a web account? Register with us today!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Mouse polyclonal antibody raised against a partial recombinant COPE.

The product of this gene is an epsilon subunit of coatomer protein complex. Coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi nonclathrin-coated vesicles. It is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins. Coatomer complex consists of at least the alpha, beta, beta', gamma, delta, epsilon and zeta subunits. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq]

Sequence: KCSPTLLLLNGQAACHMAQGRWEAAEGLLQEALDKDSGYPETLVNLIVLSQHLGKPPEVTNRYLSQLKDAHRSHPFIKEYQAKENDFDRLVLQYAPSA

Spécification

Antigène coatomer protein complex, subunit epsilon
Applications ELISA, Western Blot
Classification Polyclonal
Conjugué Unconjugated
Description Mouse polyclonal antibody raised against a partial recombinant COPE.
Formule 50% glycerol
Expression COPE
Numéro d’ordre du gène NM_007263
Alias de gène FLJ13241/epsilon-COP
Symboles de gène(s) COPE
Espèces hôtes Mouse
Immunogène COPE (NP_009194, 211 a.a. ∼ 308 a.a) partial recombinant protein with GST tag.
Quantité 50 μL
État réglementaire RUO
Molécule entière Yes
Primaire ou secondaire Primary
Identification génétique (Entrez) 11316
Espèces cibles Human
Contenu et stockage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Forme Serum
Afficher plus Afficher moins
Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.