missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticorps
  4. Anticorps primaires
  5. Tous les anticorps primaires
  6. 16102176

growth differentiation factor 11, Mouse, Polyclonal Antibody, Abnova™

Code produit 16102176
Change view
Click to view available options
Quantité:
50 μL
Conditionnement:
50µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité unitSize
16102176 50 μL 50µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 16102176 Fournisseur Abnova Code fournisseur H00010220A01.50uL

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Mouse polyclonal antibody raised against a partial recombinant GDF11.

The protein encoded by this gene is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site which is cleaved to produce a mature protein containing seven conserved cysteine residues. The members of this family are regulators of cell growth and differentiation in both embryonic and adult tissues. Studies in mice and Xenopus suggest that this protein is involved in mesodermal formation and neurogenesis during embryonic development. [provided by RefSeq

Sequence: ESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGQCEYMFMQKYPHTHLVQQANPRGSAGPCCTPTKMSPINMLYFNDKQQIIYGKIPGMVVDRCGCS

Spécification

Antigène growth differentiation factor 11
Applications ELISA, Western Blot
Classification Polyclonal
Conjugué Unconjugated
Description Mouse polyclonal antibody raised against a partial recombinant GDF11.
Formule 50% glycerol
Expression GDF11
Numéro d’ordre du gène NM_005811
Alias de gène BMP-11/BMP11
Symboles de gène(s) GDF11
Espèces hôtes Mouse
Immunogène GDF11 (NP_005802, 310 a.a. ∼ 407 a.a) partial recombinant protein with GST tag.
Quantité 50 μL
État réglementaire RUO
Disciplines de recherche Cytokines
Primaire ou secondaire Primary
Identification génétique (Entrez) 10220
Espèces cibles Human
Contenu et stockage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Forme Serum
Afficher plus Afficher moins
Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.