missing translation for 'onlineSavingsMsg'
Learn More

growth differentiation factor 7, Mouse, Polyclonal Antibody, Abnova™

Code produit 16172147
Change view
Click to view available options
Quantité:
50 μL
Conditionnement:
50µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité unitSize
16172147 50 μL 50µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 16172147 Fournisseur Abnova Code fournisseur H00151449A01.50uL

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Mouse polyclonal antibody raised against a partial recombinant GDF7.

This gene encodes a member of the bone morphogenetic protein (BMP) family. BMPs belong to the transforming growth factor-beta superfamily of secreted signalling molecules that regulate diverse processes in growth, repair and embryonic development. In mouse, this gene functions as an inductive signal from the roof plate required for the specification of neuronal identity in the dorsal spinal cord. [provided by RefSeq

Sequence: LGWDDWIIAPLDYEAYHCEGLCDFPLRSHLEPTNHAIIQTLLNSMAPDAAPASCCVPARLSPISILYIDAANNVVYKQYEDMVVEACGCR

Spécification

Antigène growth differentiation factor 7
Applications ELISA, Western Blot
Classification Polyclonal
Conjugué Unconjugated
Description Mouse polyclonal antibody raised against a partial recombinant GDF7.
Formule 50% glycerol
Expression GDF7
Numéro d’ordre du gène NM_182828
Alias de gène BMP12
Symboles de gène(s) GDF7
Espèces hôtes Mouse
Immunogène GDF7 (NP_878248, 361 a.a. ∼ 450 a.a) partial recombinant protein with GST tag.
Quantité 50 μL
État réglementaire RUO
Disciplines de recherche Cytokines
Molécule entière Yes
Primaire ou secondaire Primary
Identification génétique (Entrez) 151449
Espèces cibles Human
Contenu et stockage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Forme Serum
Afficher plus Afficher moins
Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.