missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ APOC1 (Human) Recombinant Protein

Human APOC1 full-length ORF ( AAH09698, 1 a.a. - 83 a.a.) recombinant protein with GST-tag at N-terminal.

Marque:  Abnova™ H00000341-P01.25ug

Informations supplémentaires : Poids : 0.00010kg

 Afficher plus de versions de ce produit

Code produit. 16151711

  • 545.00€ / 25µg
Expédition estimée: 28-06-2022
pour voir le stock disponible 

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!


Description

Description

  • Sequence: MRLFLSLPVLVVVLSIVLEGPAPAQGTPDVSSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSETFQKVKEKLKIDS
Spécification

Spécification

AAH09698
apolipoprotein C-I
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
341
Wheat germ expression system
25 μg
APOC1
GST
Vidéos
FDS
Documents
Certificats
Promotions

Promotions