Abnova™ BID (Human) Recombinant Protein

Human BID full-length ORF ( AAH09197, 1 a.a. - 195 a.a.) recombinant protein with GST-tag at N-terminal.

Marque: Abnova™ H00000637-P01.10ug

Code produit. 16142241

Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Sequence: MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD

Spécification

Numéro d’adhésion	AAH09197
Nom	BH3 interacting domain death agonist
Test du contrôle qualité	125% SDS-PAGE Stained with Coomassie Blue
Conditions de stockage	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Symbole de gène(s)	BID
Marqueur de protéine	GST

Identification génétique (Entrez)	637
Méthode de préparation	Wheat germ expression system
Quantité	10 μg
Alias de gène	FP497, MGC15319, MGC42355
Espèces	Wheat Germ (in vitro)
Tampon	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer

Suggestions de produits

Description